Open Net Zero logo

Filters

Formats:
Select...
Licenses:
Select...
Organizations:
Select...
Tags:
Select...
Shared:
Sensitivities:
Datasets
L o a d i n g
Assessment of the sustainability of geothermal development within the Truth or Consequences Hot-Springs district, New Mexico - Open-file Report 551

Between October 1, 2012 and Sept 30, 2013 NM Tech hydrology faculty and students, and personnel from the NM Bureau of Geology and Mineral Resources conducted a 1-year study to assess the subsurface flow patterns and the sustainability of the Truth or Consequences geothermal system. This report presents a summary of our findings.

0
No licence known
Tags:
electrical resistivitygeothermalgeothermal resourcesgeothermometrygroundwater chemistrygroundwater levelsgroundwater residence timegroundwater resourceshot springshydrothermalsurface water levelstemperature-depthwater levelswater wells
Formats:
HTMLPDF
New Mexico Bureau of Geology and Mineral Resourcesabout 1 year ago
Cascades/Aleutian Play Fairway Analysis: Data and Map FilesSource

Contains Excel data files used to quantifiably rank the geothermal potential of each of the young volcanic centers of the Cascade and Aleutian Arcs using world power production volcanic centers as benchmarks. Also contains shapefiles used in play fairway analysis with power plant, volcano, geochemistry and structural data.

0
No licence known
Tags:
AleutianAleutiansCascadesGIS dataMW capacitiesPFAPlay FairwayPlay Fairway AnalysisPower Plantsfumarolesgeochemistrygeochemsitry datageospatial datageothermalgeothermometrymap datamap packagerock typeshapefilesspringsstructural characteristicsstructural datasurface areasurface areastectonic settingvolcanic centersvolcanic ventswellsworld volcanic centers
Formats:
XLSXKMZmpk
National Renewable Energy Laboratory (NREL)about 1 year ago
Chemistry Data for Geothermometry Mapping of Deep Hydrothermal Reservoirs in Southeastern IdahoSource

This dataset includes chemistry of geothermal water samples of the Eastern Snake River Plain and surrounding area. The samples included in this dataset were collected during the springs and summers of 2014 and 2015. All chemical analysis of the samples were conducted in the Analytical Laboratory at the Center of Advanced Energy Studies in Idaho Falls, Idaho. This data set supersedes #425 submission and is the final submission for AOP 3.1.2.1 for INL. Isotopic data collected by Mark Conrad will be submitted in a separate file.

0
No licence known
Tags:
AASGAqueous Chemistry AnalysisCAESContent ModelIdahoNGDSSnake River PlainUSGINaqueouschemistrygeochemistrygeothermalgeothermometryhydrothermalspringswater sampleswells
Formats:
XLS
National Renewable Energy Laboratory (NREL)about 1 year ago
Effectiveness of Shallow Temperature Surveys to Target a Geothermal Reservoir at Previously Explored Site at McGee Mountain, Nevada: Final Report for U.S. Department Of Energy Grant EE-0002830Source

The McGee Mountain geothermal area was selected to test early-stage shallow temperature survey techniques and drill two slim holes to test the resource. Geothermal Technical Partners, Inc. was able to complete only a small portion of the project before lack of funding prevented further exploration work. This work included a shallow (2-meter) temperature survey, a Geoprobe survey, a close-spaced gravity survey, and several reports on geologic and transmission viability. The 18-page report includes a description of the geothermal geology of the area, geochemistry and geothermometry of nearby springs and wells, and findings from the shallow temperature survey, Geoprobe survey, close-spaced gravity survey, heat-in-place estimate, transmission viability, and an archeological survey. The report makes the following conclusions: Both the shallow 2-meter and the Geoprobe surveys are cost-effective methods to detect subsurface thermal anomalies in early-stage exploration, prior to more expensive temperature gradient drilling. The major advantages of the 2-meter survey are its extreme portability (no roads needed), cost per site measurement, and low environmental impact. The 2-meter survey's disadvantages are its inability to penetrate hard substrates and the noise effects due to solar heating of the ground. The Geoprobe's advantages are its ability to collect temperature and uncontaminated water samples, greater depth of penetration (to 60m), relatively low cost, and low environmental impact. The Geoprobe's disadvantages are its inability to go off-road or to penetrate hard substrates. Costs to perform both types of surveys are low, together less than the cost of one conventional temperature gradient well. Given the potential increase in data that these surveys can provide, this is extreme value for the exploration dollar.

0
No licence known
Tags:
GeochemistryGeologyGeoprobeMcGee MountainNevadaReportShallow temperature surveyTransmissionarchaeological clearancecostcost-effectivefeasibilitygeothermalgeothermometrygravitysurveythermal anomalies
Formats:
PDF
National Renewable Energy Laboratory (NREL)about 1 year ago
Fluid Geochemistry, Granite Springs Valley, Nevada Play Fairway AnalysisSource

This data set is associated with the Nevada Play Fairway project. Excel file 5-Area Chem contains all the major chemistry for the areas sampled in the project. New analyses are in lines 2-30, while older analyses appear below that. Field Data excel file contains both field notes and data with ninety entries showing sixty areas not sampled either because they were to dry, cold, or unable to locate. Thirty sites were sampled and their sample numbers appear in this file corresponding to those in the 5-Area Chemistry file. Excel file 5-Area Geothermometer contains a summary of geothermometers calculated for the new and historical data sets. Scanned field sheets are attached as a pdf.

0
No licence known
Tags:
GSVGranite Springs ValleyNV Great BasinNV-PFANevadaPFAanalysisassessmentcharacterizationchemistrydataenergyfield workgeochemistrygeothermalgeothermometryhistoricalnewnotesplay fairwayrecordsresource
Formats:
XLSXPDF
National Renewable Energy Laboratory (NREL)about 1 year ago
Geothermal Geodatabase for Rico Hot Springs Area and Lemon Hot Springs, Dolores and San Miguel Counties, ColoradoSource

This geodatabase was built to cover several geothermal targets developed by Flint Geothermal in 2012 during a search for high-temperature systems that could be exploited for electric power development. Several of the thermal springs have geochemistry and geothermometry values indicative of high-temperature systems. In addition, the explorationists discovered a very young Climax-style molybdenum porphyry system northeast of Rico, and drilling intersected thermal waters at depth. Datasets include: 1. Structural data collected by Flint Geothermal 2. Point information 3. Mines and prospects from the USGS MRDS dataset 4. Results of reconnaissance shallow (2 meter) temperature surveys 5. Air photo lineaments 6. Areas covered by travertine 7. Groundwater geochemistry 8. Land ownership in the Rico area 9. Georeferenced geologic map of the Rico Quadrangle, by Pratt et al. 10. Various 1:24,000 scale topographic maps

0
No licence known
Tags:
ColoradoDolores CountyGISGeochemistryGeodatabaseRicoSan Miguel Countyair photo lineamentsdatageologic mapgeologygeospatial datageothermalgeothermometrygroundwaterland ownershipmapmines and prospectspoint informationreconnaissancerico quadrangleshallow temperature surveystructuraltopographictravertine
Formats:
ZIP
National Renewable Energy Laboratory (NREL)about 1 year ago
Geothermal Geodatabase for Routt Hot Springs, Routt County, ColoradoSource

This geodatabase was built to cover several geothermal targets developed by Flint Geothermal in 2012 during a search for high-temperature systems that could be exploited for electric power development. Several of the thermal springs and wells in the Routt Hot Spring and Steamboat Springs areahave geochemistry and geothermometry values indicative of high-temperature systems. Datasets include: 1. Results of reconnaissance shallow (2 meter) temperature surveys 2. Air photo lineaments 3. Groundwater geochemistry 5. Georeferenced geologic map of Routt County 6. Various 1:24,000 scale topographic maps

0
No licence known
Tags:
ColoradoRoutt CountyRoutt Hot SpringsStrawberry Park Hot Springsair photo lineamentsgeochemistrygeologic mapgeologygeothermalgeothermometrygroundwatermapreconnaissanceshallow temperature surveytopographic map
Formats:
ZIP
National Renewable Energy Laboratory (NREL)about 1 year ago
Geothermal Geodatabase for Wagon Wheel Hot Springs, Mineral County, ColoradoSource

This geodatabase was built to cover several geothermal targets developed by Flint Geothermal in 2012 during a search for high-temperature systems that could be exploited for electric power development. Several of the thermal springs at Wagon Wheel Gap have geochemistry and geothermometry values indicative of high-temperature systems. Datasets include: 1. Results of reconnaissance shallow (2 meter) temperature surveys 2. Air photo lineaments 3. Groundwater geochemistry 4. Power lines 5. Georeferenced geologic map of Routt County 6. Various 1:24,000 scale topographic maps

0
No licence known
Tags:
ColoradoGeodatabaseMineral CountyWagon Wheel Hot Springsair photo lineamentsdatageochemistrygeologic mapgeologygeospatial datageothermalgeothermometrygroundwaterhydrologymappower linesreconnaissanceshallow temperature surveytopographictransmission lines
Formats:
ZIP
National Renewable Energy Laboratory (NREL)about 1 year ago
Geothermal Resource at the McGee Mountain Prospect, Humboldt County, NevadaSource

This report describes the geothermal resource at McGee Mountain, including: 1. Local geology 2. Thermal features 3. Known boreholes and temperature gradients 4. Geophysical surveys 5. Fluid geochemistry and geothermometry 6. Estimate of the heat-in-place Description of the heat-in-place estimate: The magnitude of the geothermal resource at McGee Mountain (Painted Hills) has been estimated using a Monte Carlo method applied to estimating heat-in-place. The method relies (along with certain other parameters) on estimates of the area, thickness and average temperature of the resource, but among these, only area has some constraint at this time. Therefore, the estimates used for thickness and temperature have been based on the characteristics of other geothermal resources in Nevada. Results yield a 90%-probable ("P90") thermal energy-in-place estimate of 87,300 MWth-years (that is, 90% of estimates are higher). We consider this to be a minimum likely value. At 50% probability ("P50") the estimate is 134,000 MWth-years. The recoverable portion of the preceding estimate of energy-in-place has also been estimated and converted into electrical energy, using values of recovery factor, rejection temperature, utilization factor, plant capacity factor and power plant life that are provided. The minimum (90% probable) estimate for generation potential is about 25 MWe for 30 years (or a total of 750 MWe-years) and at 50% probability the estimate is 52 MWe for 30 years (or a total of 1,560 MWe-years). These estimates are somewhat larger than a public-domain McGee resource estimate made by GeothermEx in 2004, because a 2-m deep temperature survey by Caldera has established continuance of the thermal anomaly about a half mile further north than previously documented. This resource estimate was made without reference to the Caldera property (project area) boundary, but it is likely that the entire magnitude of estimated resource lies within it. The estimate should be regarded with caution because there needs to be subsequent proof of area, thickness, temperature and commercial permeability by means of deep drilling and testing. No heat-in-place estimate of this type should ever be used to determine the final, installed size of a well field and power plant.

0
No licence known
Tags:
GeochemistryGeologyHeat in place estimateMcGee MountainMonte CarloNevadaReportbore holeboreholeborehole gradientfluidgeophysical surveygeophysicsgeothermalgeothermometryheat-in-placetemperature gradientthermal features
Formats:
PDF
National Renewable Energy Laboratory (NREL)about 1 year ago
Geothermometry Mapping of Deep Hydrothermal Reservoirs in Southeastern Idaho: Final ReportSource

Geothermometry Mapping of Deep Hydrothermal Reservoirs in Southeastern Idaho. Project final report with detail appendices.

0
No licence known
Tags:
EGSESRPIDIdahoSRPSnake River PlainYellowstone hotspotequilibriageothermalgeothermometryheat flow mappinghydrothermalisotropicmixing modelsreservoir temperaturetemperature-dependent mineralthermal anomalieswater chemistry
Formats:
PDF
National Renewable Energy Laboratory (NREL)about 1 year ago
McGee Mountain Geoprobe Survey, Humboldt County, NevadaSource

This shapefile contains location and attribute data for a Geoprobe temperature survey conducted by Geothermal Technical Partners, Inc. during 2010. The purpose of direct push technology (DPT) probe activity at the McGee Mtn. Project, Nevada was to 1) determine bottom hole temperatures using nominal 1.5 inch probe tooling to place resistance temperature detectors (RTD) and 2) take water samples, if possible, to characterize the geothermometry of the system. A total of 23 holes were probed in five days for a cumulative total of 857.5 ft. at 21 sites at McGee Mountain. The probed holes ranged in depth from a maximum of 75 ft to a minimum of 10 ft and averaged 37.3 ft. The average temperature of the 23 holes was 18.9 degrees C, with a range of 12.0 degrees C at site MMTG#1b to 42.0 degrees C at site MMTG#19. . No water was encountered in any of the probed holes, with the exception of MMTG#10, and no water was collected for sampling. Zip file containing Arcview shapefile in UTM11 NAD83 projection. 5 kb file size.

0
No licence known
Tags:
DPTDirect Push TechnologyMcGeeRTDResistance Temperature Detectorsexplorationgeoprobegeospatial datageothermalgeothermometricgeothermometryheat flowhumboldt countyhydrologymcgee mountainnevadaprobeshallow temperature surveyshapefilewater sampleswater sampling
Formats:
ZIPHTML
National Renewable Energy Laboratory (NREL)about 1 year ago
New Mexico Play Fairway Analysis: Conservative Ion Water Chemistry Data and Chalcedony GeothermometrySource

Compilation of boron, lithium, bromine, and silica data from wells and springs throughout New Mexico from a wide variety of sources. The chalcedony geothermometry calculation is included in this file.

0
No licence known
Tags:
NMNew MexicoPFAaqueous chemistryboronbrominechalcedony geothermometrycharacterizationchemistryconservative ionconservative ionsexplorationgeothermalgeothermometrylithiumplay fairway analysissilicatemperaturewaterwater chemistry
Formats:
XLS
National Renewable Energy Laboratory (NREL)about 1 year ago
Play Fairway Analysis CA-NV-OR: 2km Grid Based AnalysisSource

Combined geochemical and geophysical data, weighted and ranked for geothermal prospect favorability.

0
No licence known
Tags:
CA-NV-ORCaliforniaMTMedicine LakeNevadaOregonPFASan Emidiocharacterizationexplorationfaultfaultsfavorabilitygeochemistrygeophysicsgeothermalgeothermometrygrid filesheat flowheliumplay fairway anaysisprospectrankrankingsseismicitystrainstrain ratestressstructural settingvolcanismwell data
Formats:
XLSX
National Renewable Energy Laboratory (NREL)about 1 year ago
The Convergence of Heat, Groundwater, & Fracture Permeability: Innovative Play Fairway Modeling Applied to the Tularosa Basin Project ReportSource

This report details all of the work done in Phase 2 of a geothermal exploration project in Tularosa Basin, New Mexico. Data acquired as part of Phase 2 includes field geology (geological reconnaissance and mapping), gravity surveys, shallow temperature surveys, well water sampling and geothermometry, temperature logging, and magnetotelluric (MT) surveys. The new data is incorporated into new PFA models and Phase 2 plays were subsequently developed, ranked, and prioritized. This report also presents an overview of recommendations and costs for the next phase.

0
No licence known
Tags:
MTMT surveyModelNew MexicoPFAPermeabilityPhase 2Play Fairway AnalysisTularosaenergyexplorationfield geologygeophysicsgeothermalgeothermometrygravitygravity surveygroundwater samplingmagnetotelluricmappingpriorityreconnaissanceresource assessmentshallow tempshallow temperature surveytemperaturetemperature loggingwater samplingwell water sampling
Formats:
PDF
National Renewable Energy Laboratory (NREL)about 1 year ago
Tularosa Basin Play Fairway Analysis: Partial Basin and Range Heat and Zones of Critical Stress MapsSource

Interpolated maps of heat flow, temperature gradient, and quartz geothermometers are included as TIF files. Zones of critical stress map is also included as a TIF file. The zones are given a 5km diameter buffer. The study area is only a part of the Basin and Range, but it does includes the Tularosa Basin.

0
No licence known
Tags:
Basin and RangeGreat BasinNevadaQuartzUtahcritical stressextrapolationfaultfort blissgeospatial datageothermalgeothermometergeothermometrygradientheat flowheatflowinterpolationmapmapsnew mexicopermeabilitypfaplay fairway analysisquartz geothermometertemperaturetemperature gradienttularosatularosa basinzones
Formats:
ZIP
National Renewable Energy Laboratory (NREL)about 1 year ago
Washington Play Fairway Analysis Geothermal Heat and Permeability Potential GeodatabasesSource

This file contains file geodatabases of the Mount St. Helens seismic zone (MSHSZ), Wind River valley (WRV) and Mount Baker (MB) geothermal play-fairway sites in the Washington Cascades. The geodatabases include input data (feature classes) and output rasters (generated from modeling and interpolation) from the geothermal play-fairway in Washington State, USA. These data were gathered and modeled to provide an estimate of the heat and permeability potential within the play-fairways based on: mapped volcanic vents, hot springs and fumaroles, geothermometry, intrusive rocks, temperature-gradient wells, slip tendency, dilation tendency, displacement, displacement gradient, max coulomb shear stress, sigma 3, maximum shear strain rate, and dilational strain rate at 200m and 3 km depth. In addition this file contains layer files for each of the output rasters. For details on the areas of interest please see the 'Phase 1 Technical Report' in the download package. This submission also includes a file with the geothermal favorability of the Washington Cascade Range based off of an earlier statewide assessment. Additionally, within this file there are the maximum shear and dilational strain rate rasters for all of Washington State.

0
No licence known
Tags:
ArcGISCascade RangeGISGeothermal favorabilityMount BakerMount St. Helens seismic zoneSlip tendencyStrain rateWashingtonWind River valleydilation tendencydilational strain ratedisplacementdisplacement gradientfaultfavorabilityfumarolegdbgeodatabasegeospatial datageothermalgeothermometryheathot springintrusive rockmaximum Coulomb shear stressmaximum shear strain ratepermeabilitypfaplay-fairwayrisksensitivitysigma 3temeprature gradientuncertaintyvolcanic ventwashington state
Formats:
ZIPPDF
National Renewable Energy Laboratory (NREL)about 1 year ago