Open Net Zero logo

Filters

Formats:
Select...
Licenses:
Select...
Organizations:
Select...
Tags:
Select...
Shared:
Sensitivities:
Datasets
L o a d i n g
2011 Glass Buttes Exploration and DrillingSource

2011 Geothermal Technologies Program Peer Review Presentation summarizing relevance, proposed approach, and logistics of the Glass Buttes Exploration and Drilling.

0
No licence known
Tags:
3d geologic modelaeromagneticalterationbudgetdrillingexplorationfault geometryfield workgeochemicalgeophysicalgeothermalglass buttesgradientgravityhydrothermalhyperspectrallidarmineral assemblagesoregonremote sensingtemperature logstimeline
Formats:
PDF
National Renewable Energy Laboratory (NREL)about 1 year ago
A Conceptual Geologic Model for the Newberry Volcano EGS Site in Central Oregon: Constraining Heat Capacity and Permeability through Interpretation of Multicomponent Geosystems DataSource

Newberry Volcano, a voluminous (500 km3) basaltic/andesitic/rhyolitic shield volcano located near the intersection of the Cascade volcanic arc, the Oregon High Lava Plains and Brothers Fault Zone, and the northern Basin and Range Province, has been the site of geothermal exploration for more than 40 years. This has resulted in a unique resource: an extensive set of surficial and subsurface information appropriate to constrain the baseline structure of, and conditions within a high heat capacity magmatically hosted geothermal system. In 2012 and 2014 AltaRock Energy conducted repeated stimulation of an enhanced geothermal systems (EGS) prospect along the western flank of the Newberry Volcano. A surface based monitoring effort was conducted independent of these stimulation attempts in both 2012 and 2014 through a collaboration between NETL, Oregon State University and Zonge International. This program included utilization of 3-D and 4-D magnetotelluric, InSAR, ground-based interferometric radar, and microgravity observations within and surrounding the planned EGS stimulation zone. These observations as well as borehole and microseismic stress field and location solutions provided by AltaRock and its collaborators, in combination with well logs, petrologic and geochemical data sets, LIDAR mapping of fault traces and extrusive volcanics, surficial geologic mapping and seismic tomography, have resulted in development of a framework, subsurface geologic model for Newberry Volcano. The Newberry subsurface geologic model is a three-dimensional digital model constructed in EarthVision that enables lithology, directly and remotely measured material properties, and derived properties such as permeability, porosity and temperature, to be coregistered. This provides a powerful tool for characterizing and evaluating the sustainability of the site for EGS production and testing, particularly within the data-dense western portion of the volcano. The model has implications for understanding the previous EGS stimulations at Newberry as well as supporting future research and resource characterization opportunities. A portion of the Newberry area has been selected as a candidate site for the DOE FORGE (Frontier Observatory for Research in Geothermal Energy) Program through a collaboration between Pacific Northwest National Laboratory, Oregon State University, AltaRock Energy and additional partners. Thus, the conceptual geologic model presented here will support and benefit from future enhancements associated with that effort. --Mark-Moser et al. 2016

0
No licence known
Tags:
EGSNEWGENNewberryOregonconceptualconceptual modelenhanced geothermal systemgeologicgeologygeophysicalgeophysicsgeothermalheat capacitymodelmodelingmulticomponentpermeabilityvolcano
Formats:
1573769535
National Renewable Energy Laboratory (NREL)about 1 year ago
Alum Innovative Exploration Project (Ram Power Inc.)Source

Data generated from the Alum Innovative Exploration Project, one of several promising geothermal properties located in the middle to upper Miocene (~11-5 Ma, or million years BP) Silver Peak-Lone Mountain metamorphic core complex (SPCC) of the Walker Lane structural belt in Esmeralda County, west-central Nevada. The geothermal system at Alum is wholly concealed; its upper reaches discovered in the late 1970s during a regional thermal-gradient drilling campaign. The prospect boasts several shallow thermal-gradient (TG) boreholes with TG >75oC/km (and as high as 440oC/km) over 200-m intervals in the depth range 0-600 m. Possibly boiling water encountered at 239 m depth in one of these boreholes returned chemical- geothermometry values in the range 150-230oC. GeothermEx (2008) has estimated the electrical- generation capacity of the current Alum leasehold at 33 megawatts for 20 years; and the corresponding value for the broader thermal anomaly extending beyond the property at 73 megawatts for the same duration.

0
No licence known
Tags:
100 ohm10km2009201025-2926-1930 ohm300 ohm3D5kmAlumBougerChemistryEsmeralda CountyGeochemistryGeologyGeothermometryGrav-MagGravityGravity SurveyGridHistoricHorizontal Gravity GradientImperial CountyInversionLone MountainMTMagneticMagneticsModernNevadaNorth AmericaPhotographsPhotosPicturesProfileProfilesRegional TemperatureResource ModelRound 1Round 2ShallowSilver PeakTemperatureTerrainUpward Continued Regional ResidualWalker LaneWell DataWell LogsZTEMexecutive summarygeologicgeomechanicsgeophysicalgeospatial datageothermalhole 56-29magnetotelluricsmapsreportsectionsupper Miocene
Formats:
ZIPPDF
National Renewable Energy Laboratory (NREL)about 1 year ago
Appendices for Geothermal Exploration Artificial Intelligence ReportSource

The Geothermal Exploration Artificial Intelligence looks to use machine learning to spot geothermal identifiers from land maps. This is done to remotely detect geothermal sites for the purpose of energy uses. Such uses include enhanced geothermal system (EGS) applications, especially regarding finding locations for viable EGS sites. This submission includes the appendices and reports formerly attached to the Geothermal Exploration Artificial Intelligence Quarterly and Final Reports. The appendices below include methodologies, results, and some data regarding what was used to train the Geothermal Exploration AI. The methodology reports explain how specific anomaly detection modes were selected for use with the Geo Exploration AI. This also includes how the detection mode is useful for finding geothermal sites. Some methodology reports also include small amounts of code. Results from these reports explain the accuracy of methods used for the selected sites (Brady Desert Peak and Salton Sea). Data from these detection modes can be found in some of the reports, such as the Mineral Markers Maps, but most of the raw data is included the DOE Database which includes Brady, Desert Peak, and Salton Sea Geothermal Sites.

0
No licence known
Tags:
AIArcGisBradyCaliforniaDesert PeakEGSGISInSARMorphologicalMorphologyNevadaPythonSVMSWIRSalton SeaTIRVNIRZoteroanomaly detectionartificial intelligenceblindblind systembordercodeconceptual modeldatabasedeep learningdeformationenergyengineered geothermal systemenhanced geothermal systemexplorationfaultgeodatabasegeophysicalgeophysicsgeospatial datageothermalhydrothermalhydrothermally altered mineralshyperspectralhyperspectral imagingland surface temperaturemachine learningmineral markersmodelmorphological featurespreproccessedprocessed dataradarraw dataremote sensingseismicshort wavelength infraredsite detectionsupport vector machinethermal infraredvisible near infraredwell
Formats:
DOCXZIP
National Renewable Energy Laboratory (NREL)about 1 year ago
Brady Geodatabase for Geothermal Exploration Artificial IntelligenceSource

These files contain the geodatabases related to Brady's Geothermal Field. It includes all input and output files for the Geothermal Exploration Artificial Intelligence. Input and output files are sorted into three categories: raw data, pre-processed data, and analysis (post-processed data). In each of these categories there are six additional types of raster catalogs which are titled Radar, SWIR, Thermal, Geophysics, Geology, and Wells. These inputs and outputs were used with the Geothermal Exploration Artificial Intelligence to identify indicators of blind geothermal systems at the Brady Hot Springs Geothermal Site. The included zip file is a geodatabase to be used with ArcGIS and the tar file is an inclusive database that encompasses the inputs and outputs for the Brady Hot Springs Geothermal Site.

0
No licence known
Tags:
AIArcGISBradyBrady WellBrady hot springsGISLSTNevadaSVMSWIRanomaly detectionartificial intelligenceblindblind systemconceptual modeldatabasedeep learningdeformationenergyexplorationfaultfield datageodatabasegeophysicalgeophysicsgeospatial datageospatial databasegeothermalgeothermal site detectionhydrothermalhyperspectralhyperspectral imagingland surface temperaturemachine learningmodelpreprocessedprocessed dataradarrasterraw dataremote sensingseismicshort wavelength infraredsite detectionsupport vector machinevectorwell
Formats:
ZIPTARDOCX
National Renewable Energy Laboratory (NREL)about 1 year ago
Brady Hot Springs Seismic Modeling Data for Push-Pull ProjectSource

This submission includes synthetic seismic modeling data for the Push-Pull project at Brady Hot Springs, NV. The synthetic seismic is all generated by finite-difference method regarding different fracture and rock properties.

0
No licence known
Tags:
Brady Hot SpringsCO2NVNevadaVSPactive sourceboreholedataenergyfinite differencefracturefracturedgeologicgeophysicalgeophysicsgeothermalmediamodelingnon-fracturednumericalnumerical modelingpropertiespropertypush-pullrocksaturationseismicsyntheticvelocityvertical seismic profiling
Formats:
dat
National Renewable Energy Laboratory (NREL)about 1 year ago
Brady's Geothermal Field - March 2016 Vibroseis SEG-Y Files and UTM LocationsSource

PoroTomo March 2016 Updated vibroseis source locations with UTM locations. Supersedes gdr.openei.org/submissions/824. Updated vibroseis source location data for Stages 1-4, PoroTomo March 2016. This revision includes source point locations in UTM format (meters) for all four Stages of active source acquisition. Vibroseis sweep data were collected on a Signature Recorder unit (mfr Seismic Source) mounted in the vibroseis cab during the March 2016 PoroTomo active seismic survey Stages 1 to 4. Each sweep generated a GPS timed SEG-Y file with 4 input channels and a 20 second record length. Ch1 = pilot sweep, Ch2 = accelerometer output from the vibe's mass, Ch3 = accel output from the baseplase, and Ch4 = weighted sum of the accelerometer outputs. SEG-Y files are available via the links below. These data are available for download without login credentials through the free and publicly accessible Open Energy Data Initiative (OEDI) data viewer which allows users to browse and download individual or groups of files.

0
No licence known
Tags:
DASDASVEGSPoroTomoactive seismicactive sourcegeophysicalgeophysicsgeothermalmetadatasegyseismic datasource locationssurveysweep datatruckutmvibroseis
Formats:
PDFTXTDOCXHTMLtgz
National Renewable Energy Laboratory (NREL)about 1 year ago
Brady's Geothermal Field Active Source Seismic Survey MetaDataSource

Sweep parameters, source locations and trigger timing for the four Phases of active source seismic data acquisition.

0
No licence known
Tags:
Brady GeothermalEGSactive sourcegeophysicalgeophysicsgeothermalporotomoseismicsource locationtrigger timevibroseis
Formats:
XLSXHTML
National Renewable Energy Laboratory (NREL)about 1 year ago
Brady's Geothermal Field DAS Vibroseis DataSource

The submitted data correspond to the monitored vibrations caused by a vibroseis seismically exciting the ground in the vertical direction and captured by the DAS horizontal and vertical arrays during the PoroTomo Experiment. The data also include a file with the acceleration record at the Vibroseis. Vibroseis Sweep Details: Sweep on location T84 Stage 4 (Mode P 60 s long record ) Time: 2016-03-25 14:01:15 (UTC) Location: 39.80476089N, -119.0027625W Elevation: 1272.0M (on ground surface at the site) Sweep length: 20 seconds Frequencies: 5 Hz to 20 Hz

0
No licence known
Tags:
Accelerometer responseDASDistributed Acoustic SensingHorizontal DASNVPorotomoVertical DASVibroseisactive sourcegeophysicalgeophysicsgeothermalseg-ysegyseismicsweeptruck
Formats:
sgyHTML
National Renewable Energy Laboratory (NREL)about 1 year ago
Brady's Geothermal Field Nodal Seismometer Active Source Data SampleSource

This data is in sac format and includes recordings of two active source events from 238 three-component nodal seismometers deployed at Bradys Hot Springs geothermal field as part of the PoroTomo project. The source was a viberoseis truck operating in P-wave vibrational mode and generating a swept-frequency signal. The files are 33 seconds long starting 4 seconds before each sweep was initiated. There is some overlap in the file times.

0
No licence known
Tags:
Active seismicBrady Hot Springs geothermal fieldBradys Hot SpringsNVNevadaactive source seismicsdatageophysicalgeophysicsgeothermalnodalraw dataseismometerswept-frequency sourcevibroseis
Formats:
ZIPHTML
National Renewable Energy Laboratory (NREL)about 1 year ago
Brady's Geothermal Field Nodal Seismometer DataSource

This submission includes links to raw data, field notes, metadata, and p-wave arrival auto-picks from processed data (not provided) from the nodal seismometer array deployed at the PoroTomo Natural Laboratory in Brady's Hot Springs, Nevada during the March 2016 testing. The data is available as continuous or windowed (to vibroseis sweep) files and is stored in an AWS S3 bucket. Note: No raw data was recovered from stations 73 and 82. These data are available for download without login credentials through the free and publicly accessible Open Energy Data Initiative (OEDI) data viewer which allows users to browse and download individual or groups of files.

0
No licence known
Tags:
BradyBrady Hot Springs geothermal fieldBradys Hot SpringsNevadaPoroTomoSwept-frequency sourceactive source seismicsarrayarrivalfield notesgeophysicalgeophysicsgeothermalmetadatanodal seismometerp-wavesurveysweepvibroseis
Formats:
HTML
National Renewable Energy Laboratory (NREL)about 1 year ago
DEVELOPMENT OF TECHNIQUES FOR OPTIMIZING SELECTION AND COMPLETION OF WESTERN TIGHT GAS SANDS

The Phase I report pointed out the similarity between the fluvial Cretaceous Farrer Formation and the fluvial Cretaceous Cedar Mountain Formation in East Central Utah. The study also shows that a strong correlation exists between the vector sum azimuth, 8, of the small scale paleocurrent indicators and the long ax~s of these low sinuosity channel fill sandstones. The Phase II report indicated that there was generally a difference in the characteristics of the small scale paleocurrent indicators between the fluvial Farrer beds and the Castlegate marine, the Sego marine marginal and the Wasatch (Green River) lacustrine and marginal lacustrine beds. It further indicated that paleocurrent direction indicators should be detected by high resolution geophysical logs. The Phase III report presented a correlation of geophysical log, core and outcrop information from the GC-1 area in Grand County, Utah. Unfortunately, the correlation was more qualitative than quantitative and pointed out the need for upgrading the tools . The Phase IV report extended the continuity studies previously made in the Western Piceance and Eastern Uinta Basins to the Green River and Wind River Basins of Wyoming. The continuity was found to be somewhat higher in the Wyoming basins, and low permeability microlayers much more prevalent as separators of the small scale sedimentary structural features. The Phase V report summarized a characterization of some of the Cretaceous and Paleozoic fluvial beds in the Green River and Wind River Basins. Stochastic models of the permeability tensors of the characterized beds might be developed if additional data on the permeabilities of the thin low permeability separating layers can be obtained. The Phase VI report presents the results of a detailed study of the Rifle Gap area in Colorado and makes a prognosis of the reservoir geometric characteristics of the fluvial Mesaverde target section at the U.S. Department of Energy multiwell experiment site. The prognosis is based on an extrapolation of the Rifle Gap study results 12 miles southwest to the multiwell area.

0
No licence known
Tags:
GeologyLithologygeophysicaloptimizingwestern tight gas sands
Formats:
.PDF
National Energy Technology Laboratory (NETL)about 1 year ago
Data Arrays for Microearthquake (MEQ) Monitoring using Deep Learning for the Newberry EGS SitesSource

The 'Machine Learning Approaches to Predicting Induced Seismicity and Imaging Geothermal Reservoir Properties' project looks to apply machine learning (ML) methods to Microearthquake (MEQ) data for imaging geothermal reservoir properties and forecasting seismic events, in order to advance geothermal exploration and safe geothermal energy production. As part of the project, this submission provides data arrays for 149 microearthquakes between the year 2012 and 2013 at the Newberry EGS Site for use with the Deep Learning Algorithm that has been developed. The data provided includes raw waveform data, location data, normalized waveform data, and processed waveform data. Penn State Geothermal Team has shared the following files from the project: - 149 microearthquakes (MEQs) between 2012 and 2013 at Newberry EGS sites, 'Normalized Waveform Inputs.npz' are normalized waveforms. - labels of 149 MEQs: Processed Waveform Inputs.npz - location labels of 149 MEQs: Location Data.npz Note: .npz is the python file format by NumPy that provides storage of array data.

0
No licence known
Tags:
EGSMEQMLNewberryNewberry Volcanic SiteNewberry VolcanoNumPyOregonPythonaiartificial intelligencecodedeep learningenergyengineered geothermal systemsenhanced geothermal systemsgeophysicalgeophysicsgeothermalmachine learningmicroearthquakemicroseismicitypreprocessedprocessed dataraw dataseismicwaveform
Formats:
npz
National Renewable Energy Laboratory (NREL)about 1 year ago
Desert Peak Geodatabase for Geothermal Exploration Artificial IntelligenceSource

These files contain the geodatabases related to the Desert Peak Geothermal Field. It includes all input and output files used in the project. The files include data categories of raw data, pre-processed data, and analysis (post-processed data). In each of these categories there are six additional types of raster catalogs including Radar, SWIR, Thermal, Geophysics, Geology, and Wells. The files for the Desert Peak Geothermal Site are used with the Geothermal Exploration Artificial Intelligence to identify indicators of blind geothermal systems. The included zip file is a geodatabase to be used with ArcGIS and the tar file is an inclusive database that encompasses the inputs and outputs for the Desert Peak Geothermal Field.

0
No licence known
Tags:
AIArcGISDesert PeakGISLSTNevadaSVMSWIRSupport Vector Machineanomaly detectionartificial intelligenceblindblind systemconceptual modeldatabasedeep learningdeformationenergyexplorationfaultgeodatabasegeophysicalgeophysicsgeospatial datageothermalgeothermal site detectionhydrothermalhyperspectralhyperspectral imagingland surface temperaturemachine learningmodelpreprocessedprocessed dataradarraw dataremote sensingshort wavelength infraredsite detectionwell
Formats:
ZIPTARDOCX
National Renewable Energy Laboratory (NREL)about 1 year ago
Developing Successful Exploration Strategies in Extended TerranesSource

We conducted a comprehensive analysis of the structural controls of geothermal systems within the Great Basin and adjacent regions. Our main objectives were to: 1) Produce a catalogue of favorable structural environments and models for geothermal systems. 2) Improve site-specific targeting of geothermal resources through detailed studies of representative sites, which included innovative techniques of slip tendency analysis of faults and 3D modeling. 3) Compare and contrast the structural controls and models in different tectonic settings. 4) Synthesize data and develop methodologies for enhancement of exploration strategies for conventional and EGS systems, reduction in the risk of drilling non-productive wells, and selecting the best EGS sites. Phase I (Year 1) involved a broad inventory of structural settings of geothermal systems in the Great Basin, Walker Lane, and southern Cascades, with the aim of developing conceptual structural models and a structural catalogue of the most favorable structural environments. This overview permitted selection of 5-6 representative sites for more detailed studies in Years 2 and 3. Sites were selected on the basis of quality of exposure, potential for development, availability of subsurface data, and type of system, so that major types of systems can be evaluated and compared. The detailed investigations included geologic mapping, kinematic analysis, stress determinations, gravity surveys, integration of available geophysical data, slip tendency analysis, and for some areas 3D modeling. In Year 3, the detailed studies were completed and data synthesized to a) compare structural controls in various tectonic settings, b) complete the structural catalogue, and c) apply knowledge to exploration strategies and selection of drilling sites.

0
No licence known
Tags:
3D modelingGreat BasinQuaternary FaultsStructural ControlsWalker Lanedrill sitedrill site selectiongeologygeophysicalgeophysicsgeothermalgravitygravity surveykinematic analysispotential for developmentslip tendancysouthern Cascadesstress determinationsubsurfacetectonic setting
Formats:
PDF
National Renewable Energy Laboratory (NREL)about 1 year ago
Exploration Gap Assessment (FY13 Update)Source

This submission contains an update to the previous Exploration Gap Assessment funded in 2012, which identify high potential hydrothermal areas where critical data are needed (gap analysis on exploration data). The uploaded data are contained in two data files for each data category: A shape (SHP) file containing the grid, and a data file (CSV) containing the individual layers that intersected with the grid. This CSV can be joined with the map to retrieve a list of datasets that are available at any given site. A grid of the contiguous U.S. was created with 88,000 10-km by 10-km grid cells, and each cell was populated with the status of data availability corresponding to five data types: 1. well data 2. geologic maps 3. fault maps 4. geochemistry data 5. geophysical data

0
No licence known
Tags:
SGWStanford Geothermal WorkshopdBase filedata coveragedata gapsexplorationfaultfault mapsgapgap assessmentgeochemistrygeochemistry datageologicgeologic mapsgeophysicalgeospatial datageothermalgeothermal prospectorindex filemineralnational geothermal data systemngdsnrelpaperprocessprojection fileraw datashapefilestructural mapsstructurewellwell datawestern US
Formats:
dBaseCSVshxprjSHPPDF
National Renewable Energy Laboratory (NREL)about 1 year ago
Fallon FORGE: Geophysics and GeochemistrySource

The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS and Nevada Bureau of Mines and Geology for the Fallon, NV area.

0
No licence known
Tags:
AeromagBasin and RangeCarson SinkCarson Sink GravityEGSFORGEFallonFallon FORGEGravityLiDARNevadaTemperatureacquisition reportbouger anomalychurchill countycomplete bougergeochemistrygeochemistygeophysicalgeophysicsgeothermalgravity gradientlogmud logrelative gravityseismicseismic profilestopographic surveyingwellwell log
Formats:
HTMLZIPXLSX
National Renewable Energy Laboratory (NREL)about 1 year ago
Full Moment Tensor Inversion SoftwareSource

The link points to a website at NCEDC to download the full moment tensors inversion software The moment tensor analysis conducted in the current project is based on the full moment tensor model described in Minson and Dreger (2008). The software including source, examples and tutorial can be obtained from ftp://ncedc.org/outgoing/dreger (download file pasi-nov282012.tar.gz). Performance criteria, mathematics and test results are provided by Minson and Dreger (2008), Ford et al. (2008, 2009, 2010, 2012) and Saikia (1994). References: Ford, S., D. Dreger and W. Walter (2008). Source Characterization of the August 6, 2007 Crandall Canyon Mine Seismic Event in Central Utah, Seism. Res. Lett., 79, 637-644. Ford, S. R., D. S. Dreger and W. R. Walter (2009). Identifying isotropic events using a regional moment tensor inversion, J. Geophys. Res., 114, B01306, doi:10.1029/2008JB005743. Ford, S. R., D. S. Dreger and W. R. Walter (2010). Network sensitivity solutions for regional moment tensor inversions, Bull. Seism. Soc. Am., 100, p. 1962-1970. Ford, S. R., W. R. Walter, and D. S. Dreger (2012). Event discrimination using regional moment 665 tensors with teleseismic-P constraints, Bull. Seism. Soc. Am. 102, 867-872. Minson, S. and D. Dreger (2008), Stable Inversions for Complete Moment Tensors, Geophys. J. Int., 174, 585-592. Saikia, C.K. (1994), Modified Frequency-Wavenumber Algorithm for Regional Seismograms using Filons Quadrature: Modeling of Lg Waves in Eastern North America. Geophys. J. Int., 118, 142-158.

0
No licence known
Tags:
EGSanalysisearthquakeenergyexamplefaultfaultingfracturefull moment tensor inversiongenerationgeophysicalgeophysicsgeothermalhydraulicinducedinjectioninversionmicroseismicitymoment tensormonitoringpassiveseismicseismicitysoftwarestimulationtutorial
Formats:
HTML
National Renewable Energy Laboratory (NREL)about 1 year ago
Glass Buttes Exploration and Drilling: 2010 Geothermal Technologies Program Peer Review PresentationSource

Glass Buttes Exploration and Drilling: 2010 Geothermal Technologies Program Peer Review Presentation, Walsh, et al, Ormat

0
No licence known
Tags:
3d geologic modelaeromagneticbudgetfault geometryfield workgeochemicalgeophysicalgeothermalglass buttesgradientgravityhydrothermal alterationhyperspectrallidarmineral assemblagesoregonpeer reviewremote sensingtemperature logstimeline
Formats:
PDF
National Renewable Energy Laboratory (NREL)about 1 year ago
Hawaii Play Fairway Analysis: Gravity ModelSource

Gravity model for the state of Hawaii. Data is from the following source: Flinders, A.F., Ito, G., Garcia, M.O., Sinton, J.M., Kauahikaua, J.P., and Taylor, B., 2013, Intrusive dike complexes, cumulate cores, and the extrusive growth of Hawaiian volcanoes: Geophysical Research Letters, v. 40, p. 3367-3373, doi:10.1002/grl.50633.

0
No licence known
Tags:
Hawaiigeophysicalgeophysicsgeospatial datageothermalgravitymodelpfa
Formats:
grd
National Renewable Energy Laboratory (NREL)about 1 year ago
Hawaii Play Fairway Analysis: MT and AMT Survey along the Saddle Road, HawaiiSource

Pierce, H.A., and Thomas, D.M., 2009, Magnetotelluric and audiomagnetotelluric groundwater survey along the Humu'ula portion of Saddle Road near and around the Pohakuloa Training Area, Hawaii: U.S. Geological Survey Open-File Report 2009, 1135, 160 p.

0
No licence known
Tags:
AMTHawaiiMTMagnetotelluricPFAPohakuloa Training AreaSaddle Roadaudiomagnetotelluricgeophysicalgeophysicsgeothermalgroundwatersurvey
Formats:
HTML
National Renewable Energy Laboratory (NREL)about 1 year ago
Hotspot Project: The Snake River Geothermal Drilling Project Initial ReportSource

The Snake River volcanic province (SRP) overlies a thermal anomaly that extends deep into the mantle; it represents one of the highest heat flow provinces in North America. The primary goal of this project is to evaluate geothermal potential in three distinct settings: (1) Kimama site: inferred high sub-aquifer geothermal gradient associated with the intrusion of mafic magmas, (2) Kimberly site: a valley-margin setting where surface heat flow may be driven by the up-flow of hot fluids along buried caldera ring-fault complexes, and (3) Mountain Home site: a more traditional fault-bounded basin with thick sedimentary cover. In-depth studies continue at all three sites, complemented by high-resolution gravity, magnetic, and seismic surveys, and by downhole geophysical logging.

0
No licence known
Tags:
aquiferbasaltdownholedrillingexplorationgeophysicalgeothermalgravityhotspothotspot projectidahokimamakimberleylithologic loglithologyloggingmagneticplainrhyoliteseismicsnake riverstratigraphic columnvolcanic province
Formats:
PDF
National Renewable Energy Laboratory (NREL)about 1 year ago
Hydrogeologic Windows: Regional Signature Detection for Blind and Traditional Geothermal Play Fairways applied to Southwestern New MexicoSource

Final Report describing regional signature detection for blind and traditional play fairways as part of Phase I of New Mexico Play Fairway Analysis. This project seeks to reduce exploration risk and identify new prospective targets using available geologic, geochemical, and geophysical data sets. Although this project focuses on southwestern New Mexico, the techniques that were developed during this project are widely applicable elsewhere, particularly in arid regions.

0
No licence known
Tags:
Geochemical TracersHydrogeologic WindowsHydrothermalHydrothermal ModelingIntegrated FrameworkNew MexicoPFAaridblind geothermalcharacterizationexplorationgeochemicalgeochemistrygeologicgeologygeophysicalgeophysicsgeothermalplay fairway analysisprospectivereportresource assessmentresource characterizationsitessystemstargettracer testtraditional geothermal
Formats:
PDF
National Renewable Energy Laboratory (NREL)about 1 year ago
MT Survey on the Glass Buttes Geothermal Exploration Project in Lake County, OregonSource

Zonge Geosciences, Inc. performed a magnetotelluric (MT) survey for the Glass Buttes Project at the request of Ormat Technologies Inc. during the period of 7 October 2010 to 8 November 2010. This report provides the deep electromagnetic data and methods that were used to assist Ormat Technologies in assessing potential geothermal resources in the area. Tensor magnetotelluric data were acquired at 30 stations in the eastern survey area and array MT data were acquired along one line, 6.8 kilometers in length in the western survey area. The survey area is located in Lake County, Oregon and lies within the Glass Butte and Hat Butte, Oregon topographic areas.

0
No licence known
Tags:
1D Inversion2D inversionLake CountyMTMT surveycomputationsdata acquisitioneast areaelectromagnetic dataenvironmental impactsenvironmental issuesgeomagnetic indicesgeophysicalgeophysicsgeothermalgeothermal resourcesglass buttesinstrumentationinversion resistivitymagnetotelluricmagnetotelluric surveyoregonparametersreportresistivity-depth sectionsafetywest area
Formats:
PDF
National Renewable Energy Laboratory (NREL)about 1 year ago
National Archive of Marine Seismic Surveys (NAMSS)

The National Archive of Marine Seismic Surveys (NAMSS) is a marine seismic reflection data archive consisting of data acquired by or contributed to U.S. Department of the Interior agencies. The USGS is committed to preserving these data on behalf of the academic community and the nation. Data are provided with free and open access. --NAMSS Team

0
No licence known
Tags:
2d seismic3d seismicgeophysicalmarinenamssoffshoreseismicsurvey
Formats:
HTML
National Energy Technology Laboratory (NETL)about 1 year ago
Nevada Great Basin Play Fairway Analysis - Reports & AppendicesSource

This project focused on defining geothermal play fairways and development of a detailed geothermal potential map of a large transect across the Great Basin region (96,000 km2), with the primary objective of facilitating discovery of commercial-grade, blind geothermal fields (i.e. systems with no surface hot springs or fumaroles) and thereby accelerating geothermal development in this promising region. Data included in this submission consists of: structural settings (target areas, recency of faulting, slip and dilation potential, slip rates, quality), regional-scale strain rates, earthquake density and magnitude, gravity data, temperature at 3 km depth, permeability models, favorability models, degree of exploration and exploration opportunities, data from springs and wells, transmission lines and wilderness areas, and published maps and theses for the Nevada Play Fairway area.

0
No licence known
Tags:
3D modelingAppendicesCarson SinkGreat BasinLiDARMTNBMGNV Great BasinNVPFANevadaPlay FairwayReportSteptoe Valleyexplorationfavorabilitygeochemicalgeodesygeodeticgeologicgeologygeophysicalgeophysicsgeothermalgravityinvestigationmagnetotelluricspreliminaryresource assessmentresource potentialseismic reflectionshallow temperaturesite assessmentslip and dilation tendancysoil gassurveythermal modeling
Formats:
PDF
National Renewable Energy Laboratory (NREL)about 1 year ago
New Mexico Play Fairway Analysis: Gamma Ray Logs and Heat Generation Calculations for SW New MexicoSource

For the New Mexico Play fairway Analysis project, gamma ray geophysical well logs from oil wells penetrating the Proterozoic basement in southwestern New Mexico were digitized. Only the portion of the log in the basement was digitized. The gamma ray logs are converted to heat production using the equation (Bucker and Rybach, 1996) : A[microW/m3] = 0.0158 (Gamma Ray [API] - 0.8).

0
No licence known
Tags:
NMNew MexicoPFAboreboreholedownholeexplorationgamma logsgamma raygamma ray logsgenerationgeophysicalgeophysicsgeothermalheatheat generationoil wellssouthwestsouthwestern New Mexicowell data
Formats:
XLSaspx
National Renewable Energy Laboratory (NREL)about 1 year ago
Newberry Caldera Conceptual Geophysical ModelSource

Conceptual model for the Newberry Caldera geothermal area. Model is centered around caldera and evaluates multiple geophysical datasets to derive a conceptual subsurface model. Includes: Conductor layer based on transient electromagnetic data from Fitterman et al., 1988 (figure 10) Base of conductor layer based on MT conductor values found in Waibel et al., 2014 (DOE document, figure 38) Resistor layer based on magnetotellurics from Fitterman et al., 1988 (figure 13). Seismic intrusives layer representing a smoothed version of 5.5 km/s seismic velocity layer defined in Beachly et al., 2012 West flank seismic body representing a fractional change in seismic velocity of 0.1, defined in Beachly et al., 2012 and Heath et al., 2015 West flank gravity body "granite" that represents a gravity anomaly identified in Waibel et al., 2014 (DOE document, figure 35) Magma chamber defined seismically, found in Heath et al., 2015 Ring fracture fault intrusions Various faults and geologic layers

0
No licence known
Tags:
EGSMTNEWGENNewberryOregoncalderaconceptualconceptual modelenhanced geothermal systemfaultsgeologic modelgeophysicalgeophysicsgeothermalgravitymagnetotelluricmodelseismicstructuresubsurface model
Formats:
HTML
National Renewable Energy Laboratory (NREL)about 1 year ago
Newberry FORGE: 3D Gravity Density Model for Newberry VolcanoSource

These data are Pacific Northwest National Lab inversions of an amalgamation of two surface gravity datasets: Davenport-Newberry gravity collected prior to 2012 stimulations and Zonge International gravity collected for the project "Novel use of 4D Monitoring Techniques to Improve Reservoir Longevity and Productivity in Enhanced Geothermal Systems" in 2012. Inversions of surface gravity recover a 3D distribution of density contrast from which intrusive igneous bodies are identified. The data indicate a body name, body type, point type, UTM X and Y coordinates, Z data is specified as meters below sea level (negative values then indicate elevations above sea level), thickness of the body in meters, suscept, density anomaly in g/cc, background density in g/cc, and density in g/cc. The model was created using a commercial gravity inversion software called ModelVision 12.0 (http://www.tensor-research.com.au/Geophysical-Products/ModelVision). The initial model is based on the seismic tomography interpretation (Beachly et al., 2012). All the gravity data used to constrain this model are on the GDR: https://gdr.openei.org/submissions/760.

0
No licence known
Tags:
EGSFORGENEWGENNewberryOregondensityenhanced geothermal systemgeophysicalgeophysicsgeothermalgravitygravity anomalygravity inversiongravity surveyinverseinversionmodelsusceptibilityupper vertex
Formats:
CSV
National Renewable Energy Laboratory (NREL)about 1 year ago
Portland DDU Feasibility Study: The Spatial and Temporal Evolution of the Portland and Tualatin Basins, Oregon, USASource

The Portland and Tualatin basins are part of the Puget-Willamette Lowland in the Cascadia forearc of Oregon and Washington. The Coast Range to the west has undergone Paleogene transtension and Neogene transpression, which is reflected in basin stratigraphy. To better understand the tectonic evolution of the region, Darby Scanlon modeled three key stratigraphic horizons and their associated depocenters (areas of maximum sediment accumulation) through space and time using well log, seismic, outcrop, aeromagnetic, and gravity data. Three isochore maps were created to constrain the location of Portland and Tualatin basin depocenters during 1) Pleistocene to mid-Miocene (0-15 Ma), 2) eruption of the Columbia River Basalt Group (CRBG, 15.5-16.5 Ma), and 3) MidMiocene to late Eocene time (~17-35 Ma). Results show that the two basins each have distinct mid-Miocene to Pleistocene depocenters. The depth to CRBG in the Portland basin reaches a maximum of ~1,640 ft, 160 ft deeper than the Tualatin basin. Although the Portland basin is separated from the Tualatin basin by the Portland Hills, inversion of gravity data suggests that the two were connected as one continuous basin prior to CRBG deposition. Local thickening of CRBG flows over a gravity low coincident with the Portland Hills suggests that Neogene transpression in the forearc reactivated the SylvanOatfield and Portland Hills faults as high angle reverse faults. This structural inversion separated the once continuous Portland and Tualatin basins in the mid-late Miocene. A change in the stress regime at that time marks the transition from Paleogene forearc extension to deformation dominated by north-south shortening due to collision of the forearc against the Canadian Coast Mountains. An eastward shift of the forearc basin ii depocenter over the Neogene likely reflects uplift of the Coast Range to the west. A change in regional stress in the mid to late-Miocene, along with uplift of the Oregon Coast Range, caused a 10-fold decrease in sediment accumulation rates across the Portland and Tualatin basins. Transpressional oblique-slip faulting continues to deform the region as the forearc undergoes clockwise rotation and collides with the rigid Canadian Coast Mountains to the north.

0
No licence known
Tags:
energyeocene basementgeophysicalgeophysicsgeothermalgeothermal explorationisochore mapsmodelingneogeneoregonpaleogeneportlandresource assementspatialtemporaltetonic eveolutiontop crbgtualatin basin
Formats:
PDF
National Renewable Energy Laboratory (NREL)about 1 year ago
SECARB Airborne Magnetic and Conductivity Survey

Airborne survey data collected as part of the SECARB project from Cranfield oil site in Franklin, Mississippi. Data includes residual magnetic intensity, calculated vertical magnetic gradient, differential conductivity depth slices, and digital videos of survey flights.

0
No licence known
Tags:
AirborneCranfieldMississippiRCSPSECARBapparent resistivityconductivitydifferential resistivityelectromagneticgeophysicalmagneticsurveys
Formats:
ZIP
National Energy Technology Laboratory (NETL)about 1 year ago
SECARB Cranfield Well Logs

Borehole logs from the SECARB project at the Cranfield oil site in Franklin, Mississippi . Well logs are a part of the geologic characterization phase of SECARB; CFU 31F-1, CFU 31F-2, CFU 31F-3 well logs from Detailed Area of Study (DAS) and other well logs. Associated Publications: Butsch, R., Brown, A. L., Bryans, B., Kolb, C., Hovorka, S. D., 2013, Integration of well-based subsurface monitoring technologies: lessons learned at SECARB study, Cranfield, MS: International Journal of Greenhouse Gas Control https://doi.org/10.1016/j.ijggc.2013.06.010.

0
No licence known
Tags:
Borehole logCranfieldDenburyEarly TestFranklin CountyGCCCMississippiNETLPhase IIIRCSPSECARBWirelinecalipercarbongamma raygeologic characterizationgeophysicalneutron porosityreservoir saturationresistivitysequestrationsonicsurveywell logging
Formats:
ZIP
National Energy Technology Laboratory (NETL)about 1 year ago
Seismic Analysis of Spatio-Temporal Fracture Generation During EGS Resource Development - Deviatoric MT, Fracture Network, and Final ReportSource

This submission contains 167 deviatoric moment tensor (MT) solutions for the seismicity observed two years prior and three years post start of injection activities at The Geysers Prati 32 EGS Demonstration. Also included is a statistical representation of the properties of 751 fractures derived from the analysis of seismicity observed two years prior and three years post start of injection activities at The Geysers Prati 32 EGS Demonstration Project. The locations of the fractures are taken from microseismic hypocenters, the fracture areas are derived from moment magnitudes via scaling relationships, and the azimuths (sigma 1) and dips (sigma 3) are derived from the results of stress analyses.

0
No licence known
Tags:
CACaliforniaDeviatoric MT SolutionsEGSGeysersHigh Temperature ReservoirThe Geysersanalysiscatalogdeviatoricearthquakeenergyeventfaultfaultingfinal reportfracturefracture networkfracture orientationfracture sizegeophysicalgeophysicsgeothermalhydraulichypocentersinducedinjectioninversionlocationmicroseismicmicroseismicitymomentmonitoringnetworkpassiveseismicseismicityshearstimulationstrainstresstensor
Formats:
CSVXLSXHTML
National Renewable Energy Laboratory (NREL)about 1 year ago
Seismic Analysis of Spatio-Temporal Fracture Generation During EGS Resource Development - Full Moment Tensors and Stress Inversion CatalogsSource

This submission contains 167 full moment tensor (MT) solutions for the seismicity observed two years prior and three years post start of injection activities. Also included are the azimuth and plunge angles for the three main stress directions sigma1, sigma 2 and sigma 3 at the Prati32 EGS demonstration site in the northwest Geysers geothermal reservoir. The data are divided into 15 time periods spanning a range of five years, including two years prior to start of injection until three years post start of injection activities.

0
No licence known
Tags:
EGSHigh Temperature ReservoirPrati 32Spatio-TemporalThe Geysersanalysisarrayazimuthcatalogdemonstrationdevelopmentearthquakeenergyenhanced geothermalfaultfaultingfracturefull MTgenerationgeophysicalgeophysicsgeothermalgeysershydraulicinducedinjectioninversionmicroseismicitymincroseismicitymomentmonitoringpassiveplungereservoirresourceseismicseismic moment tensorseismicitysolutionsstimulationstressstress changesstress orientationtensor
Formats:
XLSX
National Renewable Energy Laboratory (NREL)about 1 year ago
Snake River Plain Geothermal Play Fairway Analysis Project Active Source Seismic DataSource

This archive contains seismic shot field records for 10 profiles located in Camas Prairie, Idaho. The eight numbered .sgy files were acquired using a seismic land streamer system with an accelerated weight drop source and 72 geophones. These 10-Hz geophones were mounted on base plates and dragged behind the seismic source. Shots were acquired every 4 meters along the length of lines 500West, 550 West, 600West, 700West, 800West, 900West, 200South and 200North. The objective was to map stratigraphy and structures related to geothermal fluid flow in the upper few hundred meters. A readme file is included with descriptions of individual files. The lines names refer to to roads which are numbered relative to the distance from the county seat (the town of Fairfield) along the the main highways. For example, 500 West implies that this north-south street crosses the main road 5 miles to the west of town. The included geologic, topographic, and aerial maps show the labeled seismic lines, while the regional map shows only the line geometry and regional faulting.

0
No licence known
Tags:
CamasFairfieldIdahoPFAPrairieSRPSnake River Plainactive sourceaerialdataenergygeologicgeologygeophysicalgeophysicsgeothermalmapplay fairway analysisseismicsgysurveytopographictopography
Formats:
PDFXLSXsgyPNGTXT
National Renewable Energy Laboratory (NREL)about 1 year ago
Snake River Plain Geothermal Play Fairway Analysis Project MT DataSource

MT is measured in the field by using induction coils to measure the time-varying magnetic source for frequencies between 1000-0.001~Hz, and electric dipoles to measure the Earth's electrical response. Because the magnetic source field is polarized, orthogonal directions of the fields need to be measured to get a complete description of the fields. In all measurements collected for this project, induction coils and electric dipoles were aligned with geomagnetic north and east. MT data were collected at 22 stations with a ZEN 32-bit data logger developed by Zonge International, magnetic fields were measured with ANT-4 induction coils, and electric fields where measured with Ag-AgCl reference electrodes from Borin on 50~m dipoles. The data was collected on a repeating schedule of 10~min at 4096~samples/s and 7 hours and 50 minutes at 256 samples/s over a 20-24 hour period. To convert time series data into the frequency domain and get estimations of the impedance tensor, the processing code BIRRP was used (Chave & Thompson 2004). Simultaneous measurements were used as remote references to reduce noise and bias in the data. Chave, A. D., & Thomson, D. J. 2004. Bounded inuence magnetotelluric response function estimation. Geophys. J. Int., 157, 988-1006.

0
No licence known
Tags:
CamasIdahoMTPFAPrairieSRPSnake River Plainconductivitydataelectricalenergygeophysicalgeophysicsgeothermalmagnetotelluricsplay fairway analysisresistivity
Formats:
ZIPnc
National Renewable Energy Laboratory (NREL)about 1 year ago
Snake River Plain Play Fairway Analysis Favorability ModelsSource

This submission contains a link to two USGS data publications. Each data release contains all digital geographic data used and produced by the Snake River Plain Play Fairway Analysis for Phase 1 and Phase 2 (ArcGIS shapefiles and raster files) as well as the model processing script, tables, and documentation used to generate data outputs. Brief descriptions of data layers are in the metadata of GIS files. Greater detail is available in the Phase 1 and Phase 2 final reports (linked below). The citations for the favorability model data products are: Phase 1 DeAngelo, J., Shervais, J.W., Glen, J.M., Dobson, P.F., Liberty, L.M., Siler, D.L., Neupane, G., Newell, D.L., Evans, J.P., Gasperikova, E., Peacock, J.R., Sonnenthal, E., Nielson, D.L., Garg, S.K., Schermerhorn, W.D., and Earney, T.E., 2021, Snake River Plain Play Fairway Analysis Phase 1 Favorability Model (DE EE0006733): U.S. Geological Survey data release, https://doi.org/10.5066/P95EULTI. Phase 2 DeAngelo, J., Shervais, J.W., Glen, J.M., Dobson, P.F., Liberty, L.M., Siler, D.L., Neupane, G., Newell, D.L., Evans, J.P., Gasperikova, E., Peacock, J.R., Sonnenthal, E., Nielson, D.L., Garg, S.K., Schermerhorn, W.D., and Earney, T.E., 2021, Snake River Plain Play Fairway Analysis Phase 2 Favorability Model (DE EE0006733): U.S. Geological Survey data release, https://doi.org/10.5066/P9Y8MEZY.

0
No licence known
Tags:
ArcGISGISIdahoPFAPlay Fairway AnalysisSRPSnake River Plainblindcharacterizationenergyfavorabilitygeologicgeophysicalgeospatial datageothermalmodelmodelingprocessed datarasterresourceshapefile
Formats:
HTML
National Renewable Energy Laboratory (NREL)about 1 year ago
Snake River Plain Play Fairway Analysis: Mountain Home Geothermal Area Natural State ModelSource

The Mountain Home area is characterized by high heat flow and temperature gradient. Temperature data are available from 18 boreholes with depths equal to or greater than 200 m, 5 of which have depths ranging from ~1340 m to ~3390 m (MH-1, MH-2, Bostic1, Lawrence D No.1, and Anschutz No. 1). Although there are large variations, the average temperature gradient exceeds 80 deg C/km. Recently, high-resolution gravity, ground magnetic, magnetotelluric (MT), and seismic reflection surveys have been carried out in the area in order to define key structural features responsible for promoting permeability and fluid flow. Of particular relevance is the MT survey performed in the Mountain Home area. The included reports and papers present preliminary and final 3-D numerical models of the natural-state (i.e. pre-production state) of the Mountain Home geothermal area conditioned using the available temperature profiles from the five deep wells in addition to interpretations of MT data.

0
No licence known
Tags:
GravityMTMagnetotelluricMagnetotelluricsMountain HomeNatural StateNumerical ModelPFAPlay FairwayPlay Fairway AnalysisSRPSnake River Mountain Home ModelingSnake River PlainThermal Modelingenergygeophysicalgeophysicsgeothermalmodellingnaturalpre-productionresource assessmentstatestructuretemperaure
Formats:
PDF
National Renewable Energy Laboratory (NREL)about 1 year ago
The Use of 3D Geologic Modeling to Improve Well Targeting in Glass Buttes, OregonSource

The Glass Buttes Project includes combining a suite of high-resolution geophysical and geochemical techniques to reduce exploration risk by characterizing hydrothermal alteration, fault geometries and relationships. This is aided through geologic observation, modern remote sensing and geophysical techniques which analyze and structurally model this area prior to siting and drilling.

0
No licence known
Tags:
3DGeologic Modelingexplorationfault geometriesgeochemicalgeochemistrygeologygeophysicalgeophysicsgeothermalglass butteslidaroregonremote sensingslim holesstructural model
Formats:
PDF
National Renewable Energy Laboratory (NREL)about 1 year ago
Triggered MEQ Events on LBNL Permanent Seismic Array, Brady's EGS, March 2016Source

List of triggered events recorded on LBNL's permanent EGS seismic array at Brady's geothermal field. This submission also includes links to the NCEDC EGS Earthquake Catalog Search page and to the metadata for the seismic array installed at Brady's Geothermal Field.

0
No licence known
Tags:
BradyBradys Hot SpringsBradys geothermal fieldEGSMEQPoroTomoearthquakeearthquake cataloggeophysicalgeophysicsgeothermalinduced seismicitymicroseismicityseismicseismic monitoringseismic networkseismicitystimulation
Formats:
PDFHTML
National Renewable Energy Laboratory (NREL)about 1 year ago
Tularosa Basin Play Fairway Analysis: Raw MT Data for the McGregor Range, Fort Bliss, New MexicoSource

This is a zipped file containing raw magnetotelluric (MT) data collected as part of the Phase 2 Tularosa Basin geothermal play fairway analysis project in New Mexico. The data for each MT station are in standard .edi text files which are accompanied by graphic files illustrating details. These data cover part of McGregor Range, Fort Bliss, New Mexico. The MT survey was done by Quantec Geoscience.

0
No licence known
Tags:
Fort BlissMTMcGregor RangeNMNew MexicoTularosa basinenergygeophysicalgeophysicsgeothermalmagnetotelluricpfaplay fairway analysispotentialraw dataresourcesurvey
Formats:
ZIP
National Renewable Energy Laboratory (NREL)about 1 year ago
USGS Earthquake Hazards Program - Yellowstone RegionSource

This web site is provided by the United States Geological Survey's (USGS) Earthquake Hazards Program as part of our effort to reduce earthquake hazard in the United States. We are part of the USGS Geologic Discipline and are the USGS component of the congressionally established, multi-agency National Earthquake Hazards Reduction Program (NEHRP). The USGS participates in the NEHRP with the Federal Emergency Management Agency (FEMA), the National Institute of Standards and Technology (NIST), and the National Science Foundation (NSF). In the 2004 reauthorization of NEHRP by Congress, NIST has been given the lead role to plan and coordinate this national effort to mitigate earthquake losses by developing and applying earth science data and assessments essential for land-use planning, engineering design, and emergency preparedness decisions.

0
No licence known
Tags:
EarthquakeFederal GovernmentUS Geological SurveyUSGSgeologygeophysicalgeoscientificInformationwyomingyellowstone
Formats:
HTMLArcGIS GeoServices REST APICSVGeoJSONZIPKML
The Federal Emergency Management Agency (FEMA)about 1 year ago
USU Camas-1 Test Well: DocumentationSource

This submission contains documents that describe the USU Camas-1 test well, drilled in Camas Prairie, Idaho, in Fall 2018 and Fall 2019. The purpose of this well is to validate exploration methodologies of the Snake River Plain (SRP) Play Fairway Analysis (PFA) project.

0
No licence known
Tags:
Camas PrairieCamas-1EAIdahoIdaho Department of Water ResourcesPFAPlay Fairway AnalysisSRPSnake River PlainUSUUtah State Universityassessmentblindcharacterizationclay-richconductivitycorecultural inventorydrillingenergyenvironmentenvironmentalgeophysicalgeophysicsgeothermalgougegraniteimpactlithologiclithologypermitprospectusresistivityresourcerhyoliteseismictemperaturetest wellwell datawellborewildlifewildlife inventory
Formats:
PDFPNG
National Renewable Energy Laboratory (NREL)about 1 year ago
University of Houston Applied Geophysical Lab Database

A data collection from US, Canada, and Gulf of Mexico. Data contains seismic, well logs, and core analyses

0
No licence known
Tags:
core analysesgeophysicalwell logs
Formats:
National Energy Technology Laboratory (NETL)about 1 year ago
Utah FORGE Composite Raw Gravity Data 2021Source

This is a composite raw gravity dataset of the Utah FORGE area taken over time from December 2018 to to June 2021. The data shows differences in local gravity at different location across Utah FORGE. Included with the gravity data is the NAD83 UTM coordinates of each station in meters. More detailed information can be found in the readme included in the data resource.

0
No licence known
Tags:
FORGEFORGE gravity 2021UtahUtah FORGEUtah FORGE gravity 2021dataenergygeophysicalgeophysicsgeothermalgravimetergravitygravity dataraw dataraw gravity data
Formats:
ZIP
National Renewable Energy Laboratory (NREL)about 1 year ago
Utah FORGE: Milford Digitized Geophysical Logs from Acord 1Source

This submission includes digitalized versions of the following: McCulloch Geothermal Corp Acord 1-26 Cover Letter McCulloch Geothermal Corp Acord 1-26 Drilling Plan McCulloch Geothermal Corp Acord 1-26 Bond Documents Division of Water Rights Permission to Drill Drillers Log Geothermal Data (Mud) Log Compensated Densilog - Neutron Log Dual Induction Focused Log BHC Acoustilog Differential Temperature Log Dual Induction Focused Log Gamma Ray Neutron Log Temperature Log Caliper Temperature Log (Run 3) Densilog Gamma Ray Neutron Log Temperature Log (Run 4) Compensated Densilog Sample Log (Page 1 of 2) Report of Well Driller Stratigraphic Report (J.E. Welsh) Photographs and Negatives of Acord 1-26 Well Site (7) Petrography Report (M.J. Sweeney) Cuttings Samples (21 Boxes at Utah Core Research Center)

0
No licence known
Tags:
Acord 1BHC AcoustilogEGSFORGEMilfordRoosevelt Hot SpringsUtahWater RightsWell dataaccordacordcharacterizationcompensated densilogcuttingsdatadensilogdifferential temperaturedigitizeddrillers logdrillingdrilling plandual inductionfocused loggamma raygeophysicalgeophysicsgeothermallogmud logneutron logphotographyreport of well drillerresourcestratigraphic reportstratigraphytemperaturewellwell log
Formats:
ZIP
National Renewable Energy Laboratory (NREL)about 1 year ago
Utah FORGE: TEM and Gravity DataSource

This submission includes a gravity data in text format and as a GIS point shapefile and transient electromagnetic (TEM) raw data. Each text file additionally contains location data (UTM Zone 12, NAD83) and elevation (meters) data for that station. The gravity data shapefile was in part downloaded from PACES, University of Texas at El Paso, http://gis.utep.edu/subpages/GMData.html, and in part collected by the Utah Geological Survey (UGS) as part of the DOE GTO supported Utah FORGE geothermal energy project near Milford, Utah. The PACES data were examined and scrubbed to eliminate any questionable data. A 2.67 g/cm^3 reduction density was used for the Bouguer correction. The attribute table column headers for the gravity data shapefile are explained below. There is also metadata attached to the GIS shapefile. name: the individual gravity station name. HAE: height above ellipsoid [meter] NGVD29: vertical datum for geoid [meter] obs: observed gravity ERRG: gravity measurement error [mGal] IZTC: inner zone terrain correction [mGal] OZTC: outer zone terrain correction [mGal] Gfa: free air gravity gSBGA: Bouguer horizontal slab sCBGA: Complete Bouguer anomaly

0
No licence known
Tags:
ArcGISEGSFORGEFrontier observartory for research in geothermal energyGISMilfordMineral MountainsRoosevelt Hot SpringRoosevelt Hot SpringsTEMTEM dataUtahUtah FORGEbouger anomalycorrectionsdata reductionelectromagneticsenergygeophysicalgeophysical datageophysicsgeospatialgeospatial datageothermalgravitygravity dataprocessed dataraw datashape fileshapefilesurveytext filetime-domain emtransient electromagnetic data
Formats:
ZIP
National Renewable Energy Laboratory (NREL)about 1 year ago
Utah FORGE: Well 52-21 Logs and Data: Roosevelt Hot Spring AreaSource

This is a compilation of logs and data from Well 52-21 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. The file is in a compressed .zip format and there is a data inventory table (Excel spreadsheet) in the root folder that is a guide to the data that is accessible in subfolders.

0
No licence known
Tags:
52-21BHTEGSFORGEMilfordRoosevelt Hot SpringRoosevelt Hot SpringsUtahUtah EGSUtah FORGEUtah geothermalUtah geothermal wellsUtah well logsboreholecalipercasing schematiccharacterizationcompensated neutroncompensated sonicdownholedual inductionelectro-magneticelectromagneticflow sampleformation densityfracture identificationgeochemicalgeochemistrygeophysicalgeophysicsgeothermalgeothermal well logsgradienthistoryhydrothermal alterationlaterlogmud logporositypressure surveyresourcesite mapsubsurfacesurveytemperature surveythickness toolwater analysiswater qualitywell completionwell datawell locationswell logwell logswell schematicwireline sample
Formats:
ZIP
National Renewable Energy Laboratory (NREL)about 1 year ago
Utah FORGE: Well 9-1 Logs and Data from Roosevelt Hot Springs AreaSource

This is a compilation of logs and data from Well 9-1 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. The file is in a compressed .zip format and there is a data inventory table (Excel spreadsheet) in the root folder that is a guide to the data that is accessible in subfolders.

0
No licence known
Tags:
19759-1EGSFORGERoosevelt Hot SpringRoosevelt Hot SpringsUtahUtah FORGEUtah geothermalUtah well logsacoustic cement bondammoniaanalysisboreholecharacterizationcompensated soniccore logdaily reportdensilogdirectionaldownholeformation densitygamma raygeochemicalgeophysicalgeophysicsgeothermalgeothermal wellsinductionmilfordmudmulti-shotneutronporosityresourcesilicasubsurfacesurveytemperaturewell datawell logwell logs
Formats:
ZIP
National Renewable Energy Laboratory (NREL)about 1 year ago
Utah FORGE: Well Data for Student CompetitionSource

Well 58-32 (previously labeled MU-ESW1) was drilled near Milford Utah during Phase 2B of the FORGE Project to confirm geothermal reservoir characteristics met requirements for the final FORGE site. Well Accord-1 was drilled decades ago for geothermal exploration purposes. While the conditions encountered in the well were not suitable for developing a conventional hydrothermal system, the information obtained suggested the region may be suitable for an enhanced geothermal system. Geophysical well logs were collected in both wells to obtain useful information regarding there nature of the subsurface materials. For the recent testing of 58-32, the Utah FORGE Project contracted with the well services company Schlumberger to collect the well logs.

0
No licence known
Tags:
58-32EGSFORGEGRMU-ESW1MilfordRoosevelt Hot SpringsSPUtahUtah FORGEaccord-1calipercharacterizationconductivitydatadensityenergyexplorationgammageophysicalgeophysicsgeothermalhole diameterlithologyneutronporosityradiationreservoir characteristicsresistivityresourcesonicspecific potentialstudent competitiontemperaturethermal conductivitywellwell datawell locationswell logwell surveyx-ray diffraction
Formats:
CSVTXTlas
National Renewable Energy Laboratory (NREL)about 1 year ago