Open Net Zero logo

Filters

Formats:
Select...
Licenses:
Select...
Organizations:
Select...
Tags:
Select...
Shared:
Sensitivities:
Datasets
L o a d i n g
2022 NTD Annual Data - BreakdownsSource

This dataset details mechanical failures for each applicable agency, mode, and type of service (TOS) reporting to the National Transit Database in the 2022 report year. Only Full Reporters report breakdowns. NTD Data Tables organize and summarize data from the 2022 National Transit Database in a manner that is more useful for quick reference and summary analysis. This dataset is based on the 2022 Vehicle Maintenance database file. In years 2015-2021, you can find this data in the "Breakdowns" data table on NTD Program website, at https://transit.dot.gov/ntd/ntd-data. If you have any other questions about this table, please contact the NTD Help Desk at NTDHelp@dot.gov.

0
No licence known
Tags:
mechanical-failuresvehicle-maintenancevehicles
Formats:
CSV
US Department of Transportation4 months ago
2022 NTD Annual Data - BreakdownsSource

This dataset details mechanical failures for each applicable agency, mode, and type of service (TOS) reporting to the National Transit Database in the 2022 report year. Only Full Reporters report breakdowns. NTD Data Tables organize and summarize data from the 2022 National Transit Database in a manner that is more useful for quick reference and summary analysis. This dataset is based on the 2022 Vehicle Maintenance database file. In years 2015-2021, you can find this data in the "Breakdowns" data table on NTD Program website, at https://transit.dot.gov/ntd/ntd-data. If you have any other questions about this table, please contact the NTD Help Desk at NTDHelp@dot.gov.

0
No licence known
Tags:
mechanical-failuresvehicle-maintenancevehicles
Formats:
CSV
US Department of Transportation5 months ago
2022 NTD Annual Data - BreakdownsSource

This dataset details mechanical failures for each applicable agency, mode, and type of service (TOS) reporting to the National Transit Database in the 2022 report year. Only Full Reporters report breakdowns. NTD Data Tables organize and summarize data from the 2022 National Transit Database in a manner that is more useful for quick reference and summary analysis. This dataset is based on the 2022 Vehicle Maintenance database file. In years 2015-2021, you can find this data in the "Breakdowns" data table on NTD Program website, at https://transit.dot.gov/ntd/ntd-data. If you have any other questions about this table, please contact the NTD Help Desk at NTDHelp@dot.gov.

0
No licence known
Tags:
mechanical-failuresvehicle-maintenancevehicles
Formats:
CSV
US Department of Transportation8 months ago
2022 NTD Annual Data - BreakdownsSource

This dataset details mechanical failures for each applicable agency, mode, and type of service (TOS) reporting to the National Transit Database in the 2022 report year. Only Full Reporters report breakdowns. NTD Data Tables organize and summarize data from the 2022 National Transit Database in a manner that is more useful for quick reference and summary analysis. This dataset is based on the 2022 Vehicle Maintenance database file. In years 2015-2021, you can find this data in the "Breakdowns" data table on NTD Program website, at https://transit.dot.gov/ntd/ntd-data. If you have any other questions about this table, please contact the NTD Help Desk at NTDHelp@dot.gov.

0
No licence known
Tags:
mechanical-failuresvehicle-maintenancevehicles
Formats:
CSV
US Department of Transportation8 months ago
2022 NTD Annual Data - BreakdownsSource

This dataset details mechanical failures for each applicable agency, mode, and type of service (TOS) reporting to the National Transit Database in the 2022 report year. Only Full Reporters report breakdowns. NTD Data Tables organize and summarize data from the 2022 National Transit Database in a manner that is more useful for quick reference and summary analysis. This dataset is based on the 2022 Vehicle Maintenance database file. In years 2015-2021, you can find this data in the "Breakdowns" data table on NTD Program website, at https://transit.dot.gov/ntd/ntd-data. If you have any other questions about this table, please contact the NTD Help Desk at NTDHelp@dot.gov.

0
No licence known
Tags:
mechanical-failuresvehicle-maintenancevehicles
Formats:
CSV
US Department of Transportation8 months ago
2022 NTD Annual Data - BreakdownsSource

This dataset details mechanical failures for each applicable agency, mode, and type of service (TOS) reporting to the National Transit Database in the 2022 report year. Only Full Reporters report breakdowns. NTD Data Tables organize and summarize data from the 2022 National Transit Database in a manner that is more useful for quick reference and summary analysis. This dataset is based on the 2022 Vehicle Maintenance database file. In years 2015-2021, you can find this data in the "Breakdowns" data table on NTD Program website, at https://transit.dot.gov/ntd/ntd-data. If you have any other questions about this table, please contact the NTD Help Desk at NTDHelp@dot.gov.

0
No licence known
Tags:
mechanical-failuresvehicle-maintenancevehicles
Formats:
CSV
US Department of Transportation9 months ago
2022 NTD Annual Data - BreakdownsSource

This dataset details mechanical failures for each applicable agency, mode, and type of service (TOS) reporting to the National Transit Database in the 2022 report year. Only Full Reporters report breakdowns. NTD Data Tables organize and summarize data from the 2022 National Transit Database in a manner that is more useful for quick reference and summary analysis. This dataset is based on the 2022 Vehicle Maintenance database file. In years 2015-2021, you can find this data in the "Breakdowns" data table on NTD Program website, at https://transit.dot.gov/ntd/ntd-data. If you have any other questions about this table, please contact the NTD Help Desk at NTDHelp@dot.gov.

0
No licence known
Tags:
mechanical-failuresvehicle-maintenancevehicles
Formats:
CSV
US Department of Transportation9 months ago
2022 NTD Annual Data - BreakdownsSource

This dataset details mechanical failures for each applicable agency, mode, and type of service (TOS) reporting to the National Transit Database in the 2022 report year. Only Full Reporters report breakdowns. NTD Data Tables organize and summarize data from the 2022 National Transit Database in a manner that is more useful for quick reference and summary analysis. This dataset is based on the 2022 Vehicle Maintenance database file. In years 2015-2021, you can find this data in the "Breakdowns" data table on NTD Program website, at https://transit.dot.gov/ntd/ntd-data. If you have any other questions about this table, please contact the NTD Help Desk at NTDHelp@dot.gov.

0
No licence known
Tags:
mechanical-failuresvehicle-maintenancevehicles
Formats:
CSV
US Department of Transportation9 months ago
2022 NTD Annual Data - BreakdownsSource

This dataset details mechanical failures for each applicable agency, mode, and type of service (TOS) reporting to the National Transit Database in the 2022 report year. Only Full Reporters report breakdowns. NTD Data Tables organize and summarize data from the 2022 National Transit Database in a manner that is more useful for quick reference and summary analysis. This dataset is based on the 2022 Vehicle Maintenance database file. In years 2015-2021, you can find this data in the "Breakdowns" data table on NTD Program website, at https://transit.dot.gov/ntd/ntd-data. If you have any other questions about this table, please contact the NTD Help Desk at NTDHelp@dot.gov.

0
No licence known
Tags:
mechanical-failuresvehicle-maintenancevehicles
Formats:
CSV
US Department of Transportation9 months ago
2022 NTD Annual Data - BreakdownsSource

This dataset details mechanical failures for each applicable agency, mode, and type of service (TOS) reporting to the National Transit Database in the 2022 report year. Only Full Reporters report breakdowns. NTD Data Tables organize and summarize data from the 2022 National Transit Database in a manner that is more useful for quick reference and summary analysis. This dataset is based on the 2022 Vehicle Maintenance database file. In years 2015-2021, you can find this data in the "Breakdowns" data table on NTD Program website, at https://transit.dot.gov/ntd/ntd-data. If you have any other questions about this table, please contact the NTD Help Desk at NTDHelp@dot.gov.

0
No licence known
Tags:
mechanical-failuresvehicle-maintenancevehicles
Formats:
CSV
US Department of Transportation9 months ago
2022 NTD Annual Data - BreakdownsSource

This dataset details mechanical failures for each applicable agency, mode, and type of service (TOS) reporting to the National Transit Database in the 2022 report year. Only Full Reporters report breakdowns. NTD Data Tables organize and summarize data from the 2022 National Transit Database in a manner that is more useful for quick reference and summary analysis. This dataset is based on the 2022 Vehicle Maintenance database file. In years 2015-2021, you can find this data in the "Breakdowns" data table on NTD Program website, at https://transit.dot.gov/ntd/ntd-data. If you have any other questions about this table, please contact the NTD Help Desk at NTDHelp@dot.gov.

0
No licence known
Tags:
mechanical-failuresvehicle-maintenancevehicles
Formats:
CSV
US Department of Transportation9 months ago
Alternative Fueling Station LocationsSource

Alternative fueling stations are located throughout the United States and Canada, and their availability continues to grow. The Alternative Fuels Data Center (AFDC) maintains a website where you can find alternative fueling stations near you or on a route, obtain counts of alternative fueling stations by state, view maps, and more. The most recent dataset available for download here provides a "snapshot" of the alternative fueling station information for compressed natural gas (CNG), ethanol (E85), propane/liquefied petroleum gas (LPG), biodiesel (B20 and above), electric vehicle charging, hydrogen, and liquefied natural gas (LNG), as of July 29, 2021.

0
No licence known
Tags:
B20CNGE85EVElectricityLNGLPGalt fuelalternative fuelsalternative fuels stationsbiodieselcharging stationscompressed natural gaselectric vehiclesenergyethanolfuelfuel stationshydrogenliquefied natural gasliquefied natural gas LNGliquefied petroleum gaspropanestation locationstransportationvehicles
Formats:
CSVHTML
National Renewable Energy Laboratory (NREL)about 1 year ago
Alternative Fuels Data CenterSource

Data related to alternative fuels and advanced vehicles. Internet Archive URL: https://web.archive.org/web/2019*/http://www.afdc.energy.gov/data_download/

0
Creative Commons Attribution
Tags:
alternative fuelalternative fuel lawsfuel stationsvehicles
Formats:
ZIPTXTHTMLJSONXMLPDF
United States Department of Energyabout 1 year ago
Alternative Fuels Data CenterSource

The Alternative Fuels Data Center (AFDC) provides information, data, and tools to help fleets and other transportation decision makers find ways to reduce petroleum consumption through the use of alternative and renewable fuels, advanced vehicles, and other fuel-saving measures. The Alternative Fuels Data Center (AFDC) provides a wealth of information and data on alternative and renewable fuels, advanced vehicles, fuel-saving strategies, and emerging transportation technologies. This site features interactive tools, calculators, and mapping applications to aid in the implementation of these fuels, vehicles, and strategies. The AFDC functions as a dynamic online hub, providing information, tools, and resources for transportation decision makers seeking domestic alternatives that diversify energy sources and help businesses make wise economic choices.

0
No licence known
Tags:
B20EVEVSEalternative fuelsbio fuelbiodieselcharging stationscngcompressed natural gaselectric vehiclesethanolfuelgas stationshydrogenimplementationliquefied petroleum gasliquified natural gasliquified petroleum gaslnglocationsnatural gaspropanestationstransportationvehicles
Formats:
HTMLgov
National Renewable Energy Laboratory (NREL)about 1 year ago
Car Plates Issued in the Kingdom By Type

This dataset contains Car Plates Issued in the Kingdom By Type from 1997-2017.Note:We sum up the plates issues (new vehicles) for one lifetime's worth of vehicles. Prior to year 2017 (back to 1997 at the earliest) to get the number in 2017. (We don't include the plates issued in 2017 itself, which appears to be an outlier in this data set.)

0
No licence known
Tags:
EPScar platesvehicles
Formats:
JSONCSV
King Abdullah Petroleum Studies and Research Center (KAPSARC)3 months ago
Car Share BaysSource

The City of Sydney supports car sharing to enable more sustainable travel habits and helps keep businesses and residents connected. This data is provided by City of Sydney and provides the approximate location of car share bays and is not an indication of car availability. The following car share operators will have up-to-date locations: * Car Next Door * Flexicar * GoGet * Popcar The API provides data in GeoJSON format. For more information visit [City of Sydney Car share bay operator](https://data.cityofsydney.nsw.gov.au/datasets/car-share-bay-operator?geometry=150.877%2C-33.937%2C151.530%2C-33.837).

0
Creative Commons Attribution
Tags:
City of Sydneybaybayscarcar sharecarnextdoorcouncilflexicargogetlocationparkingpopcarroadroadssharetravelvehiclevehicles
Formats:
HTMLJSONTXT
Transport for NSW9 months ago
Car park APISource

The Car Park API provides real time and historical occupancy of selected car parks. This API provides the occupancy for Transport Park&Ride car parks. Transport Park&Ride is designed to free-up more spaces at commuter car parks for those who want to travel on public transport. The data feed contains the parking occupancy information by type in real time. The Sydney Metro stations for Tallawong, Bella Vista, Hills Showground, Cherrybrook and Kellyville are reporting real time occupancy levels. It is intended other car park occupancy data will be enabled via this API in the future. Click [here](https://transportnsw.info/travel-info/ways-to-get-around/drive/parking/transport-parkride-car-parks) for more information on Transport Park&Ride.

0
Creative Commons Attribution
Tags:
Metro NorthwestMetro stationsOpalParknRideSydney Metroapicarcar parkcarparkmetrooccupancypark and rideparkingparking spacerealtimevehicles
Formats:
apiPDF
Transport for NSW9 months ago
Chemical Transport Model Simulations of Organic Aerosol in Southern California: Model Evaluation and Gasoline and Diesel Source ContributionsSource

Gasoline- and diesel-fueled engines are ubiquitous sources of air pollution in urban environments. They emit both primary particulate matter and precursor gases that react to form secondary particulate matter in the atmosphere. In this work, we use experimentally derived inputs and parameterizations to predict concentrations and properties of organic aerosol (OA) from mobile sources in southern California using a three-dimensional chemical transport model, the Community Multiscale Air Quality Model (CMAQ). The updated model includes secondary organic aerosol (SOA) formation from unspeciated intermediate volatility organic compounds (IVOC). Compared to the treatment of OA in the traditional version of CMAQ, which is commonly used for regulatory applications, the updated model did not significantly alter the predicted OA mass concentrations but it did substantially improve predictions of OA sources and composition (e.g., POA-SOA split), and ambient IVOC concentrations. The updated model, despite substantial differences in emissions and chemistry, performs similar to a recently released research version of CMAQ. Mobile sources are predicted to contribute about 30–40 % of the OA in southern California (half of which is SOA), making mobile sources the single largest source contributor to OA in southern California. The remainder of the OA is attributed to non-mobile anthropogenic sources (e.g., cooking, biomass burning) with biogenic sources contributing less than 5 % to the total OA. Gasoline sources are predicted to contribute about thirteen times more OA than diesel sources; this difference is driven by differences in SOA production. Model predictions highlight the need to better constrain multi-generational oxidation reactions in chemical transport models. This dataset is associated with the following publication: Jathar, S., M. Woody, H. Pye, K. Baker, and A. Robinson. Chemical transport model simulations of organic aerosol in southern California: model evaluation and gasoline and diesel source contributions. Atmospheric Chemistry and Physics. Copernicus Publications, Katlenburg-Lindau, GERMANY, 17: 4305-4318, (2017).

0
No licence known
Tags:
aerosolcaliforniacalnexdieselgasolinejatharsecondary organic aerosolsoavehicles
Formats:
ZIP
United State Environmental Protection Agencyabout 1 year ago
City and County Vehicle InventoriesSource

This light-duty vehicle inventory dataset provides information on vehicle registrations by vehicle type (car vs. truck), fuel type, and model year showing the changes in adoption trends over time and average fuel economies. This data is part of a suite of state and local energy profile data available at the "State and Local Energy Profile Data Suite" link below and builds on Cities-LEAP energy modeling, available at the "EERE Cities-LEAP Page" link below. Examples of how to use the data to inform energy planning can be found at the "Example Uses" link below.

0
No licence known
Tags:
Alternative FuelCities-LEAPEVElectric VehicleFuel EconomyLight-duty vehiclescarcitycountrydieselelectric vehiclesenergyexampleflex fuelfuel typegasolinehybridhydrogenhydrogen fuel cellinventorylight dutylocalmunicipalplanningplug in hybridregistrationtransportationtruckvehiclevehicle typevehicles
Formats:
XLSBHTML
National Renewable Energy Laboratory (NREL)about 1 year ago
EPA-developed, patented technologies available for licensingSource

Under the Federal Technology Transfer Act (FTTA), Federal Agencies can patent inventions developed during the course of research. These technologies can then be licensed to businesses or individuals for further development and sale in the marketplace.

0
No licence known
Tags:
air qualitycontaminated sitesdrinking waterecological protectionfuel emissionshazardous substancesinventionpatentpollution preventionremediationtechnologytoxicologytreatmentvehicleswastewater monitoringwater quality
Formats:
API
United State Environmental Protection Agencyabout 1 year ago
Freight Transportation Energy Use

This dataset contains Freight Transportation Energy Use from 2017-2050.Note:  Includes estimated consumption for petroleum and other liquids.  Totals may not equal sum of components due to independent rounding.

0
No licence known
Tags:
ConsumptionEPSEnergyFreightvehicles
Formats:
JSONCSV
King Abdullah Petroleum Studies and Research Center (KAPSARC)3 months ago
Historical GTFS and GTFS RealtimeSource

This dataset contains historical GTFS and GTFS Realtime data. The GTFS Realtime data includes GTFS vehicle position, GTFS trip update and GTFS timetable. Initially, it provides Metro and Ferry data and include other modes over time.

0
Creative Commons Attribution
Tags:
GTFS Realtimeferrygtfshistorichistoricalrealtimetimetabletrip updatetrip updatestripsvehicle positionsvehicles
Formats:
apiPDF
Transport for NSW9 months ago
Investigations DataSource

About the Data The dataset includes publicly available NHTSA investigation information related to the identification and correction of safety-related defects in motor vehicles and vehicle equipment. For more information on NHTSA investigations, including safety defect investigations, please visit https://www.nhtsa.gov/resources-investigations-recalls.

0
No licence known
Tags:
air-bagair-bagsautocampaigncarcar-seatcarschild-safety-seatsdefectdefectsemailequipmentfmvssinvestigationinvestigationsoffice-of-defect-investigationspotential-affectedrecallrecallssafetytiretiresvehicles
Formats:
CSV
US Department of Transportation4 months ago
Investigations DataSource

About the Data The dataset includes publicly available NHTSA investigation information related to the identification and correction of safety-related defects in motor vehicles and vehicle equipment. For more information on NHTSA investigations, including safety defect investigations, please visit https://www.nhtsa.gov/resources-investigations-recalls.

0
No licence known
Tags:
air-bagair-bagsautocampaigncarcar-seatcarschild-safety-seatsdefectdefectsemailequipmentfmvssinvestigationinvestigationsoffice-of-defect-investigationspotential-affectedrecallrecallssafetytiretiresvehicles
Formats:
CSV
US Department of Transportation5 months ago
Loading Zones KerbsideSource

Location of Sydney CBD kerbside loading zones (for use by delivery vehicles when loading or unloading goods) by street and time of day (hourly). Returns ZIP file containing JSON and CSV files

0
Creative Commons Attribution
Tags:
NSW RoadsSydney CBDcouncilkerbkerbsideloadingloading zonesparkingroadstreetvehicleszone
Formats:
ZIPJSONCSVapi
Transport for NSW7 months ago
Parking OffencesSource

Parking related penalty notices issued by issuing authority, financial year and offence.

0
Creative Commons Attribution
Tags:
NSW Roadsoffenceoffencesopendataparkingpenaltiespenaltypenalty noticesroadroadsvehicles
Formats:
XLSX
Transport for NSW9 months ago
Private Sector Imports Financed Through Commercial Banks (Letters of Credit Settled and Bills Received)

Explore the Saudi Arabia Private Sector Imports dataset featuring Grand Total, Foodstuff, Building Materials, Machinery, Fruits & Vegetables, and more. Access annual data from 1993 onwards. Grand Total, Foodstuff, Food Grains, Building Materials, Machinery, Other Goods, Fruits & Vegetables, Textiles & Clothings, Motor Vehicles, Appliances, Livestock and Meat, SAMA Monthly Saudi ArabiaFollow data.kapsarc.org for timely data to advance energy economics research..Note:The data are updated. The data of foreign bank branches operating in Saudi Arabia have been amended and updated as per international best practices and the Monetary and Financial Statistics Manual.

0
No licence known
Tags:
SAMA Monthlybuildingfoodstuffgoodsmachineryvehicles
Formats:
JSONCSV
King Abdullah Petroleum Studies and Research Center (KAPSARC)3 months ago
Public Registers Online - Reg of Authorised Treatment Facilities for End of Life VehiclesSource

Find Authorised Treatment Sites (ATF) depolluting and dismantling End of Life Vehicles (ELV)..

0
Other (Public Domain)
Tags:
EnvironmentUKregistersvehicles
Formats:
ZIPHTML
Department for Environment Food & Rural Affairs (DEFRA)about 1 year ago
Public Transport - Realtime Vehicle PositionsSource

Current vehicle positions in GTFS-realtime format for Buses, Ferries, Light Rail, Trains, Metro and Regional Bus Services (our regional services are at times referenced as "TCB" - Transport Connected Bus). An up to date list of all TCB services can be found [on the forum](https://opendataforum.transport.nsw.gov.au/t/new-real-time-regional-bus-data-is-now-available/2060).

0
Creative Commons Attribution
Tags:
GTFS RealtimeTransport Connected BusTransportationbusesferriesgtfsgtfs rgtfsrlightrailmetropublicpublic transportreal-timereal-time alertsrealtimerealtime apirealtime positionsrealtime vehicleregionalregional bus servicestcbtrainstransportvehicle positionsvehicles
Formats:
api
Transport for NSW5 months ago
Public Transport - Realtime Vehicle Positions v2Source

Current vehicle positions in GTFS-realtime format for Metro and Sydney Trains.

0
Creative Commons Attribution
Tags:
GTFS RealtimeSydney TrainsTransportationgtfsgtfs rgtfsrmetropublicpublic transportreal-timereal-time alertsrealtimerealtime apirealtime positionsrealtime vehicletrainstransportv2v2 feedvehicle postionsvehiclesversion 2
Formats:
apiTXT
Transport for NSW5 months ago
Recalls DataSource

About the Data: The dataset includes recall information related to specific NHTSA campaigns. Users can filter based on characteristics like manufacturer and component. The dataset can also be filtered by recall type: tires, vehicles, car seats, and equipment. The earliest campaign data is from 1966. The dataset displays the completion rate from the latest Recall Quarterly Report or Annual Report data from Year 2015 Quarter 1 (2015-1) onward. Data Reporting Requirement: Manufacturers who determine that a product or piece of original equipment either contains a safety defect or is not in compliance with Federal safety standards are required to notify NHTSA within 5 business days. NHTSA requires that manufacturers file a Defect and Noncompliance Report in compliance with Federal Regulation 49 (the National Traffic and Motor Safety Act) Part 573, which identifies the requirements for safety recalls. This information is stored in the NHTSA database referenced above. Notes: The default visualization depicted here represents only the top 12 manufacturers for the current calendar year. Please use the Filters for specific data requests. For a complete historical perspective, please visit: https://www.nhtsa.gov/sites/nhtsa.gov/files/2023-03/2022-Recalls-Annual-Report_030223-tag.pdf.

0
No licence known
Tags:
air-bagair-bagsautocampaigncarcar-seatcarschild-safety-seatschild-seatdefectemailequipmentfmvsshttpsafercargovoffice-of-defect-investigationspotential-affectedrecallrecallssafetytiretiresvehiclevehiclesvinvin-search
Formats:
CSV
US Department of Transportation4 months ago
Recalls DataSource

About the Data: The dataset includes recall information related to specific NHTSA campaigns. Users can filter based on characteristics like manufacturer and component. The dataset can also be filtered by recall type: tires, vehicles, car seats, and equipment. The earliest campaign data is from 1966. The dataset displays the completion rate from the latest Recall Quarterly Report or Annual Report data from Year 2015 Quarter 1 (2015-1) onward. Data Reporting Requirement: Manufacturers who determine that a product or piece of original equipment either contains a safety defect or is not in compliance with Federal safety standards are required to notify NHTSA within 5 business days. NHTSA requires that manufacturers file a Defect and Noncompliance Report in compliance with Federal Regulation 49 (the National Traffic and Motor Safety Act) Part 573, which identifies the requirements for safety recalls. This information is stored in the NHTSA database referenced above. Notes: The default visualization depicted here represents only the top 12 manufacturers for the current calendar year. Please use the Filters for specific data requests. For a complete historical perspective, please visit: https://www.nhtsa.gov/sites/nhtsa.gov/files/2023-03/2022-Recalls-Annual-Report_030223-tag.pdf.

0
No licence known
Tags:
air-bagair-bagsautocampaigncarcar-seatcarschild-safety-seatschild-seatdefectemailequipmentfmvsshttpsafercargovoffice-of-defect-investigationspotential-affectedrecallrecallssafetytiretiresvehiclevehiclesvinvin-search
Formats:
CSV
US Department of Transportation5 months ago
Recalls DataSource

About the Data: The dataset includes recall information related to specific NHTSA campaigns. Users can filter based on characteristics like manufacturer and component. The dataset can also be filtered by recall type: tires, vehicles, car seats, and equipment. The earliest campaign data is from 1966. The dataset displays the completion rate from the latest Recall Quarterly Report or Annual Report data from Year 2015 Quarter 1 (2015-1) onward. Data Reporting Requirement: Manufacturers who determine that a product or piece of original equipment either contains a safety defect or is not in compliance with Federal safety standards are required to notify NHTSA within 5 business days. NHTSA requires that manufacturers file a Defect and Noncompliance Report in compliance with Federal Regulation 49 (the National Traffic and Motor Safety Act) Part 573, which identifies the requirements for safety recalls. This information is stored in the NHTSA database referenced above. Notes: The default visualization depicted here represents only the top 12 manufacturers for the current calendar year. Please use the Filters for specific data requests. For a complete historical perspective, please visit: https://www.nhtsa.gov/sites/nhtsa.gov/files/2023-03/2022-Recalls-Annual-Report_030223-tag.pdf.

0
No licence known
Tags:
air-bagair-bagsautocampaigncarcar-seatcarschild-safety-seatschild-seatdefectemailequipmentfmvsshttpsafercargovoffice-of-defect-investigationspotential-affectedrecallrecallssafetytiretiresvehiclevehiclesvinvin-search
Formats:
CSV
US Department of Transportation5 months ago
Recalls DataSource

About the Data: The dataset includes recall information related to specific NHTSA campaigns. Users can filter based on characteristics like manufacturer and component. The dataset can also be filtered by recall type: tires, vehicles, car seats, and equipment. The earliest campaign data is from 1966. The dataset displays the completion rate from the latest Recall Quarterly Report or Annual Report data from Year 2015 Quarter 1 (2015-1) onward. Data Reporting Requirement: Manufacturers who determine that a product or piece of original equipment either contains a safety defect or is not in compliance with Federal safety standards are required to notify NHTSA within 5 business days. NHTSA requires that manufacturers file a Defect and Noncompliance Report in compliance with Federal Regulation 49 (the National Traffic and Motor Safety Act) Part 573, which identifies the requirements for safety recalls. This information is stored in the NHTSA database referenced above. Notes: The default visualization depicted here represents only the top 12 manufacturers for the current calendar year. Please use the Filters for specific data requests. For a complete historical perspective, please visit: https://www.nhtsa.gov/sites/nhtsa.gov/files/2023-03/2022-Recalls-Annual-Report_030223-tag.pdf.

0
No licence known
Tags:
air-bagair-bagsautocampaigncarcar-seatcarschild-safety-seatschild-seatdefectemailequipmentfmvsshttpsafercargovoffice-of-defect-investigationspotential-affectedrecallrecallssafetytiretiresvehiclevehiclesvinvin-search
Formats:
CSV
US Department of Transportation8 months ago
Recalls DataSource

About the Data: The dataset includes recall information related to specific NHTSA campaigns. Users can filter based on characteristics like manufacturer and component. The dataset can also be filtered by recall type: tires, vehicles, car seats, and equipment. The earliest campaign data is from 1966. The dataset displays the completion rate from the latest Recall Quarterly Report or Annual Report data from Year 2015 Quarter 1 (2015-1) onward. Data Reporting Requirement: Manufacturers who determine that a product or piece of original equipment either contains a safety defect or is not in compliance with Federal safety standards are required to notify NHTSA within 5 business days. NHTSA requires that manufacturers file a Defect and Noncompliance Report in compliance with Federal Regulation 49 (the National Traffic and Motor Safety Act) Part 573, which identifies the requirements for safety recalls. This information is stored in the NHTSA database referenced above. Notes: The default visualization depicted here represents only the top 12 manufacturers for the current calendar year. Please use the Filters for specific data requests. For a complete historical perspective, please visit: https://www.nhtsa.gov/sites/nhtsa.gov/files/2023-03/2022-Recalls-Annual-Report_030223-tag.pdf.

0
No licence known
Tags:
air-bagair-bagsautocampaigncarcar-seatcarschild-safety-seatschild-seatdefectemailequipmentfmvsshttpsafercargovoffice-of-defect-investigationspotential-affectedrecallrecallssafetytiretiresvehiclevehiclesvinvin-search
Formats:
CSV
US Department of Transportation8 months ago
Recalls DataSource

About the Data: The dataset includes recall information related to specific NHTSA campaigns. Users can filter based on characteristics like manufacturer and component. The dataset can also be filtered by recall type: tires, vehicles, car seats, and equipment. The earliest campaign data is from 1966. The dataset displays the completion rate from the latest Recall Quarterly Report or Annual Report data from Year 2015 Quarter 1 (2015-1) onward. Data Reporting Requirement: Manufacturers who determine that a product or piece of original equipment either contains a safety defect or is not in compliance with Federal safety standards are required to notify NHTSA within 5 business days. NHTSA requires that manufacturers file a Defect and Noncompliance Report in compliance with Federal Regulation 49 (the National Traffic and Motor Safety Act) Part 573, which identifies the requirements for safety recalls. This information is stored in the NHTSA database referenced above. Notes: The default visualization depicted here represents only the top 12 manufacturers for the current calendar year. Please use the Filters for specific data requests. For a complete historical perspective, please visit: https://www.nhtsa.gov/sites/nhtsa.gov/files/2023-03/2022-Recalls-Annual-Report_030223-tag.pdf.

0
No licence known
Tags:
air-bagair-bagsautocampaigncarcar-seatcarschild-safety-seatschild-seatdefectemailequipmentfmvsshttpsafercargovoffice-of-defect-investigationspotential-affectedrecallrecallssafetytiretiresvehiclevehiclesvinvin-search
Formats:
CSV
US Department of Transportation8 months ago
Recalls DataSource

About the Data: The dataset includes recall information related to specific NHTSA campaigns. Users can filter based on characteristics like manufacturer and component. The dataset can also be filtered by recall type: tires, vehicles, car seats, and equipment. The earliest campaign data is from 1966. The dataset displays the completion rate from the latest Recall Quarterly Report or Annual Report data from Year 2015 Quarter 1 (2015-1) onward. Data Reporting Requirement: Manufacturers who determine that a product or piece of original equipment either contains a safety defect or is not in compliance with Federal safety standards are required to notify NHTSA within 5 business days. NHTSA requires that manufacturers file a Defect and Noncompliance Report in compliance with Federal Regulation 49 (the National Traffic and Motor Safety Act) Part 573, which identifies the requirements for safety recalls. This information is stored in the NHTSA database referenced above. Notes: The default visualization depicted here represents only the top 12 manufacturers for the current calendar year. Please use the Filters for specific data requests. For a complete historical perspective, please visit: https://www.nhtsa.gov/sites/nhtsa.gov/files/2023-03/2022-Recalls-Annual-Report_030223-tag.pdf.

0
No licence known
Tags:
air-bagair-bagsautocampaigncarcar-seatcarschild-safety-seatschild-seatdefectemailequipmentfmvsshttpsafercargovoffice-of-defect-investigationspotential-affectedrecallrecallssafetytiretiresvehiclevehiclesvinvin-search
Formats:
CSV
US Department of Transportation8 months ago
Recalls DataSource

About the Data: The dataset includes recall information related to specific NHTSA campaigns. Users can filter based on characteristics like manufacturer and component. The dataset can also be filtered by recall type: tires, vehicles, car seats, and equipment. The earliest campaign data is from 1966. The dataset displays the completion rate from the latest Recall Quarterly Report or Annual Report data from Year 2015 Quarter 1 (2015-1) onward. Data Reporting Requirement: Manufacturers who determine that a product or piece of original equipment either contains a safety defect or is not in compliance with Federal safety standards are required to notify NHTSA within 5 business days. NHTSA requires that manufacturers file a Defect and Noncompliance Report in compliance with Federal Regulation 49 (the National Traffic and Motor Safety Act) Part 573, which identifies the requirements for safety recalls. This information is stored in the NHTSA database referenced above. Notes: The default visualization depicted here represents only the top 12 manufacturers for the current calendar year. Please use the Filters for specific data requests. For a complete historical perspective, please visit: https://www.nhtsa.gov/sites/nhtsa.gov/files/2023-03/2022-Recalls-Annual-Report_030223-tag.pdf.

0
No licence known
Tags:
air-bagair-bagsautocampaigncarcar-seatcarschild-safety-seatschild-seatdefectemailequipmentfmvsshttpsafercargovoffice-of-defect-investigationspotential-affectedrecallrecallssafetytiretiresvehiclevehiclesvinvin-search
Formats:
CSV
US Department of Transportation8 months ago
Recalls DataSource

About the Data: The dataset includes recall information related to specific NHTSA campaigns. Users can filter based on characteristics like manufacturer and component. The dataset can also be filtered by recall type: tires, vehicles, car seats, and equipment. The earliest campaign data is from 1966. The dataset displays the completion rate from the latest Recall Quarterly Report or Annual Report data from Year 2015 Quarter 1 (2015-1) onward. Data Reporting Requirement: Manufacturers who determine that a product or piece of original equipment either contains a safety defect or is not in compliance with Federal safety standards are required to notify NHTSA within 5 business days. NHTSA requires that manufacturers file a Defect and Noncompliance Report in compliance with Federal Regulation 49 (the National Traffic and Motor Safety Act) Part 573, which identifies the requirements for safety recalls. This information is stored in the NHTSA database referenced above. Notes: The default visualization depicted here represents only the top 12 manufacturers for the current calendar year. Please use the Filters for specific data requests. For a complete historical perspective, please visit: https://www.nhtsa.gov/sites/nhtsa.gov/files/2023-03/2022-Recalls-Annual-Report_030223-tag.pdf.

0
No licence known
Tags:
air-bagair-bagsautocampaigncarcar-seatcarschild-safety-seatschild-seatdefectemailequipmentfmvsshttpsafercargovoffice-of-defect-investigationspotential-affectedrecallrecallssafetytiretiresvehiclevehiclesvinvin-search
Formats:
CSV
US Department of Transportation8 months ago
Recalls DataSource

About the Data: The dataset includes recall information related to specific NHTSA campaigns. Users can filter based on characteristics like manufacturer and component. The dataset can also be filtered by recall type: tires, vehicles, car seats, and equipment. The earliest campaign data is from 1966. The dataset displays the completion rate from the latest Recall Quarterly Report or Annual Report data from Year 2015 Quarter 1 (2015-1) onward. Data Reporting Requirement: Manufacturers who determine that a product or piece of original equipment either contains a safety defect or is not in compliance with Federal safety standards are required to notify NHTSA within 5 business days. NHTSA requires that manufacturers file a Defect and Noncompliance Report in compliance with Federal Regulation 49 (the National Traffic and Motor Safety Act) Part 573, which identifies the requirements for safety recalls. This information is stored in the NHTSA database referenced above. Notes: The default visualization depicted here represents only the top 12 manufacturers for the current calendar year. Please use the Filters for specific data requests. For a complete historical perspective, please visit: https://www.nhtsa.gov/sites/nhtsa.gov/files/2023-03/2022-Recalls-Annual-Report_030223-tag.pdf.

0
No licence known
Tags:
air-bagair-bagsautocampaigncarcar-seatcarschild-safety-seatschild-seatdefectemailequipmentfmvsshttpsafercargovoffice-of-defect-investigationspotential-affectedrecallrecallssafetytiretiresvehiclevehiclesvinvin-search
Formats:
CSV
US Department of Transportation9 months ago
Recalls DataSource

About the Data: The dataset includes recall information related to specific NHTSA campaigns. Users can filter based on characteristics like manufacturer and component. The dataset can also be filtered by recall type: tires, vehicles, car seats, and equipment. The earliest campaign data is from 1966. The dataset displays the completion rate from the latest Recall Quarterly Report or Annual Report data from Year 2015 Quarter 1 (2015-1) onward. Data Reporting Requirement: Manufacturers who determine that a product or piece of original equipment either contains a safety defect or is not in compliance with Federal safety standards are required to notify NHTSA within 5 business days. NHTSA requires that manufacturers file a Defect and Noncompliance Report in compliance with Federal Regulation 49 (the National Traffic and Motor Safety Act) Part 573, which identifies the requirements for safety recalls. This information is stored in the NHTSA database referenced above. Notes: The default visualization depicted here represents only the top 12 manufacturers for the current calendar year. Please use the Filters for specific data requests. For a complete historical perspective, please visit: https://www.nhtsa.gov/sites/nhtsa.gov/files/2023-03/2022-Recalls-Annual-Report_030223-tag.pdf.

0
No licence known
Tags:
air-bagair-bagsautocampaigncarcar-seatcarschild-safety-seatschild-seatdefectemailequipmentfmvsshttpsafercargovoffice-of-defect-investigationspotential-affectedrecallrecallssafetytiretiresvehiclevehiclesvinvin-search
Formats:
CSV
US Department of Transportation9 months ago
Recalls DataSource

About the Data: The dataset includes recall information related to specific NHTSA campaigns. Users can filter based on characteristics like manufacturer and component. The dataset can also be filtered by recall type: tires, vehicles, car seats, and equipment. The earliest campaign data is from 1966. The dataset displays the completion rate from the latest Recall Quarterly Report or Annual Report data from Year 2015 Quarter 1 (2015-1) onward. Data Reporting Requirement: Manufacturers who determine that a product or piece of original equipment either contains a safety defect or is not in compliance with Federal safety standards are required to notify NHTSA within 5 business days. NHTSA requires that manufacturers file a Defect and Noncompliance Report in compliance with Federal Regulation 49 (the National Traffic and Motor Safety Act) Part 573, which identifies the requirements for safety recalls. This information is stored in the NHTSA database referenced above. Notes: The default visualization depicted here represents only the top 12 manufacturers for the current calendar year. Please use the Filters for specific data requests. For a complete historical perspective, please visit: https://www.nhtsa.gov/sites/nhtsa.gov/files/2023-03/2022-Recalls-Annual-Report_030223-tag.pdf.

0
No licence known
Tags:
air-bagair-bagsautocampaigncarcar-seatcarschild-safety-seatschild-seatdefectemailequipmentfmvsshttpsafercargovoffice-of-defect-investigationspotential-affectedrecallrecallssafetytiretiresvehiclevehiclesvinvin-search
Formats:
CSV
US Department of Transportation9 months ago
Recalls DataSource

About the Data: The dataset includes recall information related to specific NHTSA campaigns. Users can filter based on characteristics like manufacturer and component. The dataset can also be filtered by recall type: tires, vehicles, car seats, and equipment. The earliest campaign data is from 1966. The dataset displays the completion rate from the latest Recall Quarterly Report or Annual Report data from Year 2015 Quarter 1 (2015-1) onward. Data Reporting Requirement: Manufacturers who determine that a product or piece of original equipment either contains a safety defect or is not in compliance with Federal safety standards are required to notify NHTSA within 5 business days. NHTSA requires that manufacturers file a Defect and Noncompliance Report in compliance with Federal Regulation 49 (the National Traffic and Motor Safety Act) Part 573, which identifies the requirements for safety recalls. This information is stored in the NHTSA database referenced above. Notes: The default visualization depicted here represents only the top 12 manufacturers for the current calendar year. Please use the Filters for specific data requests. For a complete historical perspective, please visit: https://www.nhtsa.gov/sites/nhtsa.gov/files/2023-03/2022-Recalls-Annual-Report_030223-tag.pdf.

0
No licence known
Tags:
air-bagair-bagsautocampaigncarcar-seatcarschild-safety-seatschild-seatdefectemailequipmentfmvsshttpsafercargovoffice-of-defect-investigationspotential-affectedrecallrecallssafetytiretiresvehiclevehiclesvinvin-search
Formats:
CSV
US Department of Transportation9 months ago
Recalls DataSource

About the Data: The dataset includes recall information related to specific NHTSA campaigns. Users can filter based on characteristics like manufacturer and component. The dataset can also be filtered by recall type: tires, vehicles, car seats, and equipment. The earliest campaign data is from 1966. The dataset displays the completion rate from the latest Recall Quarterly Report or Annual Report data from Year 2015 Quarter 1 (2015-1) onward. Data Reporting Requirement: Manufacturers who determine that a product or piece of original equipment either contains a safety defect or is not in compliance with Federal safety standards are required to notify NHTSA within 5 business days. NHTSA requires that manufacturers file a Defect and Noncompliance Report in compliance with Federal Regulation 49 (the National Traffic and Motor Safety Act) Part 573, which identifies the requirements for safety recalls. This information is stored in the NHTSA database referenced above. Notes: The default visualization depicted here represents only the top 12 manufacturers for the current calendar year. Please use the Filters for specific data requests. For a complete historical perspective, please visit: https://www.nhtsa.gov/sites/nhtsa.gov/files/2023-03/2022-Recalls-Annual-Report_030223-tag.pdf.

0
No licence known
Tags:
air-bagair-bagsautocampaigncarcar-seatcarschild-safety-seatschild-seatdefectemailequipmentfmvsshttpsafercargovoffice-of-defect-investigationspotential-affectedrecallrecallssafetytiretiresvehiclevehiclesvinvin-search
Formats:
CSV
US Department of Transportation9 months ago
Recalls DataSource

About the Data: The dataset includes recall information related to specific NHTSA campaigns. Users can filter based on characteristics like manufacturer and component. The dataset can also be filtered by recall type: tires, vehicles, car seats, and equipment. The earliest campaign data is from 1966. The dataset displays the completion rate from the latest Recall Quarterly Report or Annual Report data from Year 2015 Quarter 1 (2015-1) onward. Data Reporting Requirement: Manufacturers who determine that a product or piece of original equipment either contains a safety defect or is not in compliance with Federal safety standards are required to notify NHTSA within 5 business days. NHTSA requires that manufacturers file a Defect and Noncompliance Report in compliance with Federal Regulation 49 (the National Traffic and Motor Safety Act) Part 573, which identifies the requirements for safety recalls. This information is stored in the NHTSA database referenced above. Notes: The default visualization depicted here represents only the top 12 manufacturers for the current calendar year. Please use the Filters for specific data requests. For a complete historical perspective, please visit: https://www.nhtsa.gov/sites/nhtsa.gov/files/2023-03/2022-Recalls-Annual-Report_030223-tag.pdf.

0
No licence known
Tags:
air-bagair-bagsautocampaigncarcar-seatcarschild-safety-seatschild-seatdefectemailequipmentfmvsshttpsafercargovoffice-of-defect-investigationspotential-affectedrecallrecallssafetytiretiresvehiclevehiclesvinvin-search
Formats:
CSV
US Department of Transportation9 months ago
Recalls DataSource

About the Data: The dataset includes recall information related to specific NHTSA campaigns. Users can filter based on characteristics like manufacturer and component. The dataset can also be filtered by recall type: tires, vehicles, car seats, and equipment. The earliest campaign data is from 1966. The dataset displays the completion rate from the latest Recall Quarterly Report or Annual Report data from Year 2015 Quarter 1 (2015-1) onward. Data Reporting Requirement: Manufacturers who determine that a product or piece of original equipment either contains a safety defect or is not in compliance with Federal safety standards are required to notify NHTSA within 5 business days. NHTSA requires that manufacturers file a Defect and Noncompliance Report in compliance with Federal Regulation 49 (the National Traffic and Motor Safety Act) Part 573, which identifies the requirements for safety recalls. This information is stored in the NHTSA database referenced above. Notes: The default visualization depicted here represents only the top 12 manufacturers for the current calendar year. Please use the Filters for specific data requests. For a complete historical perspective, please visit: https://www.nhtsa.gov/sites/nhtsa.gov/files/2023-03/2022-Recalls-Annual-Report_030223-tag.pdf.

0
No licence known
Tags:
air-bagair-bagsautocampaigncarcar-seatcarschild-safety-seatschild-seatdefectemailequipmentfmvsshttpsafercargovoffice-of-defect-investigationspotential-affectedrecallrecallssafetytiretiresvehiclevehiclesvinvin-search
Formats:
CSV
US Department of Transportation9 months ago
Recalls DataSource

About the Data: The dataset includes recall information related to specific NHTSA campaigns. Users can filter based on characteristics like manufacturer and component. The dataset can also be filtered by recall type: tires, vehicles, car seats, and equipment. The earliest campaign data is from 1966. The dataset displays the completion rate from the latest Recall Quarterly Report or Annual Report data from Year 2015 Quarter 1 (2015-1) onward. Data Reporting Requirement: Manufacturers who determine that a product or piece of original equipment either contains a safety defect or is not in compliance with Federal safety standards are required to notify NHTSA within 5 business days. NHTSA requires that manufacturers file a Defect and Noncompliance Report in compliance with Federal Regulation 49 (the National Traffic and Motor Safety Act) Part 573, which identifies the requirements for safety recalls. This information is stored in the NHTSA database referenced above. Notes: The default visualization depicted here represents only the top 12 manufacturers for the current calendar year. Please use the Filters for specific data requests. For a complete historical perspective, please visit: https://www.nhtsa.gov/sites/nhtsa.gov/files/2023-03/2022-Recalls-Annual-Report_030223-tag.pdf.

0
No licence known
Tags:
air-bagair-bagsautocampaigncarcar-seatcarschild-safety-seatschild-seatdefectemailequipmentfmvsshttpsafercargovoffice-of-defect-investigationspotential-affectedrecallrecallssafetytiretiresvehiclevehiclesvinvin-search
Formats:
CSV
US Department of Transportation9 months ago
Recalls DataSource

About the Data: The dataset includes recall information related to specific NHTSA campaigns. Users can filter based on characteristics like manufacturer and component. The dataset can also be filtered by recall type: tires, vehicles, car seats, and equipment. The earliest campaign data is from 1966. The dataset displays the completion rate from the latest Recall Quarterly Report or Annual Report data from Year 2015 Quarter 1 (2015-1) onward. Data Reporting Requirement: Manufacturers who determine that a product or piece of original equipment either contains a safety defect or is not in compliance with Federal safety standards are required to notify NHTSA within 5 business days. NHTSA requires that manufacturers file a Defect and Noncompliance Report in compliance with Federal Regulation 49 (the National Traffic and Motor Safety Act) Part 573, which identifies the requirements for safety recalls. This information is stored in the NHTSA database referenced above. Notes: The default visualization depicted here represents only the top 12 manufacturers for the current calendar year. Please use the Filters for specific data requests. For a complete historical perspective, please visit: https://www.nhtsa.gov/sites/nhtsa.gov/files/2023-03/2022-Recalls-Annual-Report_030223-tag.pdf.

0
No licence known
Tags:
air-bagair-bagsautocampaigncarcar-seatcarschild-safety-seatschild-seatdefectemailequipmentfmvsshttpsafercargovoffice-of-defect-investigationspotential-affectedrecallrecallssafetytiretiresvehiclevehiclesvinvin-search
Formats:
CSV
US Department of Transportation9 months ago
Sydney Region CarriagewaySource

A carriageway is width of roadway for the movement of vehicles. There are single carriageways and dual carriageways represented as single or dual lines in the spatial representation. This dataset contains the the number of through lanes, the width of the through lanes and the surfaced width for State Roads. There are also non-state roads in the dataset, which commonly only contain lengths and no widths.

0
Creative Commons Attribution
Tags:
State RoadsSydneycarriagewaydual lineslaneslengthregionroadroadwaysingle linesspatialstatesurfaces widththrough lanesvehicleswidth
Formats:
ZIPPDF
Transport for NSW9 months ago
Vehicles Imported by Type

This datasets contains Information about imported Vehicles. by model for 2014-2019.Data is from General Authority of Statistics.

0
No licence known
Tags:
importsvehicles
Formats:
JSONCSV
King Abdullah Petroleum Studies and Research Center (KAPSARC)3 months ago